Clone BO19826 Report

Search the DGRC for BO19826

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:26
Vector:pDNR-Dual
Associated Gene/TranscriptHP4-RA
Protein status:BO19826.pep: Imported from assembly
Sequenced Size:352

Clone Sequence Records

BO19826.complete Sequence

352 bp assembled on 2009-05-13

GenBank Submission: KX797662

> BO19826.complete
GAAGTTATCAGTCGACATGTCACCGAAGACTAAAAAAATGATCGTCAAGA
TTCCGCGCCATCCCTACTTCAATGTGCAGGGCGAACGGAGCGTGGAGCGC
GAGGTGGAGTACCAGGTCCGAAAGTGTCGCGTGAATCTGGAGCGCATCAA
GTCGTCGACTTCTCCGAATTCCCGTCCATTCCCGTTAAAACCGAAGCCCA
AGAGATGCATTGTACGTGTAGCCCGACTGCCGGACGTGGAGCGCAGCGAG
ATTTCCGTGACACCGGCCAGTTCCATCATGAATTCCGACATTGACGAGAA
TAGTGGCAGCGATCAGGAGTCTAATCTGACAATCGCAAGCTTTCTAGACC
AT

BO19826.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-RA 321 CG8044-PA 1..318 17..334 1590 100 Plus
HP4-RB 303 CG8044-PB 1..287 17..303 1420 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-RA 643 CG8044-RA 110..428 16..334 1595 100 Plus
HP4-RB 717 CG8044-RB 110..397 16..303 1425 99.7 Plus
HP4-RB 717 CG8044-RB 468..502 300..334 175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7975758..7976045 303..16 1425 99.7 Minus
Blast to na_te.dros performed 2014-11-27 13:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2027..2089 80..18 108 63.5 Minus

BO19826.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:43 Download gff for BO19826.complete
Subject Subject Range Query Range Percent Splice Strand
Hip-RA 108..425 17..336 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:38 Download gff for BO19826.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 111..428 17..336 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:58:10 Download gff for BO19826.complete
Subject Subject Range Query Range Percent Splice Strand
HP4-RA 111..428 17..336 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:58:10 Download gff for BO19826.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7975651..7975687 300..336 94 <- Minus
3L 7975762..7976044 17..299 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:38 Download gff for BO19826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7968862..7969144 17..299 100   Minus
arm_3L 7968751..7968787 300..336 94 <- Minus

BO19826.pep Sequence

Translation from 16 to 352

> BO19826.pep
MSPKTKKMIVKIPRHPYFNVQGERSVEREVEYQVRKCRVNLERIKSSTSP
NSRPFPLKPKPKRCIVRVARLPDVERSEISVTPASSIMNSDIDENSGSDQ
ESNLTIASFLDH

BO19826.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:21:03
Subject Length Description Subject Range Query Range Score Percent Strand
HP4-PA 106 CG8044-PA 1..106 1..106 541 100 Plus
HP4-PB 100 CG8044-PB 1..95 1..95 483 98.9 Plus