BO19837.complete Sequence
301 bp assembled on 2009-05-13
GenBank Submission: KX794249
> BO19837.complete
GAAGTTATCAGTCGACATGGCACTGCAGCTGCAAATTGAGAAGCTCAAAG
GTTTGGACAACTACAAGGCCTGGTCGATGACGGTGCGGGCGTATCTGGAG
TCGGAGGAACTCTGGACGGTGGTGGAGAATGGTCCCGAGAACAACGAGGA
GTCCCTGCTAAAGGACAAGCGGGCCAAGTTCTTGATTCTCTGCCTGATCG
AGACCAAGTTGTGCCAATTCATGGTCAGCATCCGCACGGCTCGGGATCTG
TGGAATTACTTGCGCACCCAGCATTCGCTGCGTGCAAGCTTTCTAGACCA
T
BO19837.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:52:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG18598-RA | 270 | CG18598-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:52:27
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG18598-RA | 360 | CG18598-RA | 30..296 | 17..283 | 1335 | 100 | Plus |
| CG12320-RB | 1666 | CG12320-RB | 1457..1591 | 151..17 | 675 | 100 | Minus |
| CG12320-RB | 1666 | CG12320-RB | 1260..1393 | 283..150 | 670 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 06:52:25
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 18251144..18251278 | 17..151 | 675 | 100 | Plus |
| 3R | 32079331 | 3R | 18251342..18251475 | 150..283 | 670 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 06:52:26
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 412 | 7567 | 412 412 7567bp | 163..212 | 191..240 | 106 | 68 | Plus |
| 412 | 7567 | 412 412 7567bp | 7216..7265 | 191..240 | 106 | 68 | Plus |
BO19837.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:41 Download gff for
BO19837.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG18598-RA | 31..297 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:17 Download gff for
BO19837.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG18598-RA | 31..297 | 17..285 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:56:47 Download gff for
BO19837.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG18598-RA | 30..296 | 17..285 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 07:56:47 Download gff for
BO19837.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 18251344..18251475 | 152..285 | 98 | | Plus |
| 3R | 18251144..18251278 | 17..151 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:17 Download gff for
BO19837.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 14076866..14077000 | 17..151 | 100 | -> | Plus |
| arm_3R | 14077066..14077197 | 152..285 | 98 | | Plus |
BO19837.pep Sequence
Translation from 16 to 301
> BO19837.pep
MALQLQIEKLKGLDNYKAWSMTVRAYLESEELWTVVENGPENNEESLLKD
KRAKFLILCLIETKLCQFMVSIRTARDLWNYLRTQHSLRASFLDH
BO19837.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:20:56
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG18598-PA | 89 | CG18598-PA | 1..89 | 1..89 | 461 | 100 | Plus |
