Clone BO19844 Report

Search the DGRC for BO19844

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:198
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG16704-RA
Protein status:BO19844.pep: Imported from assembly
Sequenced Size:271

Clone Sequence Records

BO19844.complete Sequence

271 bp assembled on 2009-05-13

GenBank Submission: KX794995

> BO19844.complete
GAAGTTATCAGTCGACATGAAATACCTAGTCGTTTTTGCACTCATCTGCT
GTCTTGTGGCATCAGCATTTGCGACTTTGAAAAACCCAATCTGTGGCGAG
GAGTTTGGCGTCAAGGGTACTTGCCGTTCCCTGCAACCCATGTGGACCTA
TCGCCCAGATACGAACGAGTGCTTCACCTTCAATTACTCCGGCTGCCACG
GAAACAATAATCTATTCCACAAAAAGTTGGAGTGCGAAGAAAAATGCAAA
ATAGCAAGCTTTCTAGACCAT

BO19844.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-RB 240 CG16704-PB 1..237 17..253 1185 100 Plus
CG16704-RA 240 CG16704-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-RB 350 CG16704-RB 48..284 17..253 1185 100 Plus
CG16704-RA 335 CG16704-RA 48..284 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3692189..3692355 253..87 835 100 Minus
2L 23513712 2L 3692471..3692540 86..17 350 100 Minus
Blast to na_te.dros performed on 2014-11-27 07:41:16 has no hits.

BO19844.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:37 Download gff for BO19844.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 49..285 17..255 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:52:02 Download gff for BO19844.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 48..284 17..255 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:02:49 Download gff for BO19844.complete
Subject Subject Range Query Range Percent Splice Strand
CG16704-RA 48..284 17..255 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:02:49 Download gff for BO19844.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692187..3692355 87..255 98 <- Minus
2L 3692471..3692540 17..86 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:52:02 Download gff for BO19844.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3692187..3692355 87..255 98 <- Minus
arm_2L 3692471..3692540 17..86 100   Minus

BO19844.pep Sequence

Translation from 16 to 271

> BO19844.pep
MKYLVVFALICCLVASAFATLKNPICGEEFGVKGTCRSLQPMWTYRPDTN
ECFTFNYSGCHGNNNLFHKKLECEEKCKIASFLDH

BO19844.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:20:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG16704-PB 79 CG16704-PB 1..79 1..79 448 100 Plus
CG16704-PA 79 CG16704-PA 1..79 1..79 448 100 Plus
CG16713-PA 82 CG16713-PA 1..80 1..77 169 43.2 Plus
CG16712-PB 82 CG16712-PB 1..81 1..78 166 42.7 Plus
CG16712-PA 82 CG16712-PA 1..81 1..78 166 42.7 Plus