Clone BO19940 Report

Search the DGRC for BO19940

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:199
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG6503-RA
Protein status:BO19940.pep: Imported from assembly
Sequenced Size:220

Clone Sequence Records

BO19940.complete Sequence

220 bp assembled on 2009-07-17

GenBank Submission: KX797907

> BO19940.complete
GAAGTTATCAGTCGACATGCTTTTGAAATGCACTTGGCTATTGGTTTTGC
TGCTGTCCGTAATGGCAGGTGCCTTTGCCAGCAGCGGATGTCCTGCGGGA
TATAGTGCCGAGAACAATCGGTGCACCATTGAGCGTCCTGTTCACGGCTC
CTGTCCACCCGGATCCTCCTACAGCCTGAACATCAACAAGTGCGTCCACT
CCGCAAGCTTTCTAGACCAT

BO19940.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-RB 189 CG6503-PB 1..186 17..202 930 100 Plus
CG6503-RC 189 CG6503-PC 1..186 17..202 930 100 Plus
CG6503-RA 189 CG6503-PA 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-RB 348 CG6503-RB 48..235 15..202 940 100 Plus
CG6503-RC 353 CG6503-RC 53..240 15..202 940 100 Plus
CG6503-RA 408 CG6503-RA 108..295 15..202 940 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 26424811..26424998 202..15 940 100 Minus
Blast to na_te.dros performed on 2014-11-27 15:45:16 has no hits.

BO19940.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 12:13:25 Download gff for BO19940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..295 17..204 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:32 Download gff for BO19940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..295 17..204 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:43 Download gff for BO19940.complete
Subject Subject Range Query Range Percent Splice Strand
CG6503-RA 110..295 17..204 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:15:43 Download gff for BO19940.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26424809..26424996 17..204 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:32 Download gff for BO19940.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22250531..22250718 17..204 98   Minus

BO19940.pep Sequence

Translation from 16 to 220

> BO19940.pep
MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS
SYSLNINKCVHSASFLDH

BO19940.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG6503-PB 62 CG6503-PB 1..62 1..62 336 100 Plus
CG6503-PC 62 CG6503-PC 1..62 1..62 336 100 Plus
CG6503-PA 62 CG6503-PA 1..62 1..62 336 100 Plus
CG34291-PA 61 CG34291-PA 4..59 6..61 135 35.7 Plus