BO19940.complete Sequence
220 bp assembled on 2009-07-17
GenBank Submission: KX797907
> BO19940.complete
GAAGTTATCAGTCGACATGCTTTTGAAATGCACTTGGCTATTGGTTTTGC
TGCTGTCCGTAATGGCAGGTGCCTTTGCCAGCAGCGGATGTCCTGCGGGA
TATAGTGCCGAGAACAATCGGTGCACCATTGAGCGTCCTGTTCACGGCTC
CTGTCCACCCGGATCCTCCTACAGCCTGAACATCAACAAGTGCGTCCACT
CCGCAAGCTTTCTAGACCAT
BO19940.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6503-RB | 189 | CG6503-PB | 1..186 | 17..202 | 930 | 100 | Plus |
CG6503-RC | 189 | CG6503-PC | 1..186 | 17..202 | 930 | 100 | Plus |
CG6503-RA | 189 | CG6503-PA | 1..186 | 17..202 | 930 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6503-RB | 348 | CG6503-RB | 48..235 | 15..202 | 940 | 100 | Plus |
CG6503-RC | 353 | CG6503-RC | 53..240 | 15..202 | 940 | 100 | Plus |
CG6503-RA | 408 | CG6503-RA | 108..295 | 15..202 | 940 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:45:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 26424811..26424998 | 202..15 | 940 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 15:45:16 has no hits.
BO19940.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-27 12:13:25 Download gff for
BO19940.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6503-RA | 110..295 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:52:32 Download gff for
BO19940.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6503-RA | 110..295 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:15:43 Download gff for
BO19940.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6503-RA | 110..295 | 17..204 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:15:43 Download gff for
BO19940.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 26424809..26424996 | 17..204 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:52:32 Download gff for
BO19940.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 22250531..22250718 | 17..204 | 98 | | Minus |
BO19940.pep Sequence
Translation from 16 to 220
> BO19940.pep
MLLKCTWLLVLLLSVMAGAFASSGCPAGYSAENNRCTIERPVHGSCPPGS
SYSLNINKCVHSASFLDH
BO19940.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:50:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG6503-PB | 62 | CG6503-PB | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PC | 62 | CG6503-PC | 1..62 | 1..62 | 336 | 100 | Plus |
CG6503-PA | 62 | CG6503-PA | 1..62 | 1..62 | 336 | 100 | Plus |
CG34291-PA | 61 | CG34291-PA | 4..59 | 6..61 | 135 | 35.7 | Plus |