Clone BO20224 Report

Search the DGRC for BO20224

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:202
Well:24
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO20224.pep: Imported from assembly
Sequenced Size:199

Clone Sequence Records

BO20224.complete Sequence

199 bp assembled on 2009-05-13

> BO20224.complete
GAAGTTATCAGTCGACATGTGTCTTACTAACTTAATGTCTCGACGAGCAA
CACCGAAGAAAATATTCTCAGATAATGGCACAAATTTCAACGGAGAAGGT
GGGGAAGGAAGAACTAAAAAGGTGGACTTTGGAAAACTTCTTGTTAAATA
TGACCAGATTAAGTTGCCCAAGAGAGAGTTGGCAAGCTTTCTAGACCAT

BO20224.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 07:34:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 07:34:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4621551..4621715 181..17 825 100 Minus
Blast to na_te.dros performed 2014-11-27 07:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
rooA 7621 rooA ROOA_LTR 7621bp 5135..5188 42..95 134 76.4 Plus

BO20224.complete Sim4 Records

Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:54 Download gff for BO20224.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4621549..4621715 17..183 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:00:54 Download gff for BO20224.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4621549..4621715 17..183 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:27 Download gff for BO20224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 509054..509220 17..183 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:23:27 Download gff for BO20224.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 509054..509220 17..183 98   Minus

BO20224.pep Sequence

Translation from 16 to 199

> BO20224.pep
MCLTNLMSRRATPKKIFSDNGTNFNGEGGEGRTKKVDFGKLLVKYDQIKL
PKRELASFLDH
Sequence BO20224.pep has no blast hits.