Clone BO20239 Report

Search the DGRC for BO20239

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:202
Well:39
Vector:pDNR-Dual
Associated Gene/TranscriptCG31555-RB
Protein status:BO20239.pep: full length peptide match
Sequenced Size:268

Clone Sequence Records

BO20239.complete Sequence

268 bp assembled on 2009-05-13

GenBank Submission: KX799979

> BO20239.complete
GAAGTTATCAGTCGACATGTTAGCTGAACAACCGTATATATATATATATA
GTATATATATTACATATATGTATGTATATACAGACACCCACATACGAGCG
CCAATAGAGCGAGATACACCCGTTTTTATTGTGCTGCGCATTTTCAACGT
GCGGCTGAACTGTGAATTCGAGTATAGTACCCTAGATATAGGTAGAATCG
GTACAAACCAGGTGGTACAGGTGGCATCGCGTGCAAAGCCGCACTTGATG
GCAAGCTTTCTAGACCAT

BO20239.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 13:56:17 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG11000-RC 6816 CG11000-RC 5031..5264 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5811473..5811706 17..250 1170 100 Plus
Blast to na_te.dros performed 2014-11-27 13:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 997..1043 122..168 100 68.1 Plus

BO20239.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:36:53 Download gff for BO20239.complete
Subject Subject Range Query Range Percent Splice Strand
CG31555-RA 240..468 22..252 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:36:05 Download gff for BO20239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11000-RC 5036..5264 22..252 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:30:17 Download gff for BO20239.complete
Subject Subject Range Query Range Percent Splice Strand
CG11000-RC 5036..5264 22..252 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:30:17 Download gff for BO20239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5811478..5811706 22..252 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:36:05 Download gff for BO20239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1637200..1637428 22..252 99   Plus

BO20239.pep Sequence

Translation from 16 to 268

> BO20239.pep
MLAEQPYIYIYSIYITYMYVYTDTHIRAPIERDTPVFIVLRIFNVRLNCE
FEYSTLDIGRIGTNQVVQVASRAKPHLMASFLDH
Sequence BO20239.pep has no blast hits.