BO20443.complete Sequence
205 bp assembled on 2009-05-13
GenBank Submission: KX796529
> BO20443.complete
GAAGTTATCAGTCGACATGGCTTTCCGCATACCTTTTGGCAAGAAGCACG
CTGAGATAGCGAGTTCCTTCATCCGATCTGGAGCCGGATTCGGAGGAGCT
GCTGGCCTGGCCGTGCTTTACTACACCGACTGGAAGCTGGTCCTACAGTA
CGTGCCCATCTACGGATCCAAGTTCGAAAAAAGCGAGGCAAGCTTTCTAG
ACCAT
BO20443.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 00:21:37
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14482-RB | 174 | CG14482-PB | 1..171 | 17..187 | 855 | 100 | Plus |
| CG14482-RA | 174 | CG14482-PA | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 00:21:39
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14482-RB | 561 | CG14482-RB | 81..251 | 17..187 | 855 | 100 | Plus |
| CG14482-RA | 324 | CG14482-RA | 81..251 | 17..187 | 855 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 00:21:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 17572406..17572523 | 187..70 | 590 | 100 | Minus |
| 2R | 25286936 | 2R | 17572652..17572704 | 69..17 | 265 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 00:21:36 has no hits.
BO20443.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:45 Download gff for
BO20443.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14482-RA | 51..221 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:23:03 Download gff for
BO20443.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14482-RA | 81..251 | 17..189 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:30:30 Download gff for
BO20443.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG14482-RA | 81..251 | 17..189 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:30:30 Download gff for
BO20443.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 17572404..17572523 | 70..189 | 98 | <- | Minus |
| 2R | 17572652..17572704 | 17..69 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:23:03 Download gff for
BO20443.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 13459909..13460028 | 70..189 | 98 | <- | Minus |
| arm_2R | 13460157..13460209 | 17..69 | 100 | | Minus |
BO20443.pep Sequence
Translation from 16 to 205
> BO20443.pep
MAFRIPFGKKHAEIASSFIRSGAGFGGAAGLAVLYYTDWKLVLQYVPIYG
SKFEKSEASFLDH
BO20443.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:55:15
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG14482-PB | 57 | CG14482-PB | 1..57 | 1..57 | 296 | 100 | Plus |
| CG14482-PA | 57 | CG14482-PA | 1..57 | 1..57 | 296 | 100 | Plus |
| CG43206-PA | 72 | CG43206-PA | 18..66 | 9..57 | 130 | 49 | Plus |
