BO20494.complete Sequence
307 bp assembled on 2009-05-13
GenBank Submission: KX796300
> BO20494.complete
GAAGTTATCAGTCGACATGTCCATCATGGAGGGCTCTGCGGATATTTTCC
TGGAACTCCGCGAAAAATTCGTGCCGACTTTTATGCGTTCCTGCATTTTC
TGGTTGCCCGCGCAGGCCTTGAACTTTTCCCTGGTTGCACCCCGATTCCG
TGTCATCTATATGGGTATTTGTGGATTGATTTGGGTGAATATTCTATGTT
GGACCAAGCGGCAAAGTCTTCCAGTCGCAACGAAAGAAATTGCAACTGAT
TCAAATAATAATGCAGCTGCCATAAGGAATTCCGAAACAGCAAGCTTTCT
AGACCAT
BO20494.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:35:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-RE | 615 | CG12355-PE | 339..612 | 16..289 | 1370 | 100 | Plus |
CG12355-RB | 615 | CG12355-PB | 339..612 | 16..289 | 1370 | 100 | Plus |
CG12355-RD | 276 | CG12355-PD | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:35:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-RE | 1026 | CG12355-RE | 661..934 | 16..289 | 1370 | 100 | Plus |
CG12355-RD | 791 | CG12355-RD | 426..699 | 16..289 | 1370 | 100 | Plus |
CG12355-RB | 817 | CG12355-RB | 452..725 | 16..289 | 1370 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:35:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 15493056..15493329 | 289..16 | 1370 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 14:35:56 has no hits.
BO20494.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:46 Download gff for
BO20494.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RB | 340..612 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:30:49 Download gff for
BO20494.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RB | 453..725 | 17..291 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:48:50 Download gff for
BO20494.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12355-RB | 453..725 | 17..291 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:48:50 Download gff for
BO20494.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 15493053..15493328 | 17..291 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:30:49 Download gff for
BO20494.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 15486153..15486428 | 17..291 | 99 | | Minus |
BO20494.pep Sequence
Translation from 16 to 307
> BO20494.pep
MSIMEGSADIFLELREKFVPTFMRSCIFWLPAQALNFSLVAPRFRVIYMG
ICGLIWVNILCWTKRQSLPVATKEIATDSNNNAAAIRNSETASFLDH
BO20494.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:55:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12355-PD | 91 | CG12355-PD | 1..91 | 1..91 | 474 | 100 | Plus |
CG12355-PA | 91 | CG12355-PA | 1..91 | 1..91 | 474 | 100 | Plus |
CG12355-PE | 204 | CG12355-PE | 114..204 | 1..91 | 474 | 100 | Plus |
CG12355-PB | 204 | CG12355-PB | 114..204 | 1..91 | 474 | 100 | Plus |