Clone BO20612 Report

Search the DGRC for BO20612

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:206
Well:12
Vector:pDNR-Dual
Associated Gene/TranscriptTsp42Er-RA
Protein status:BO20612.pep: Imported from assembly
Sequenced Size:667

Clone Sequence Records

BO20612.complete Sequence

667 bp assembled on 2009-05-13

GenBank Submission: KX796314

> BO20612.complete
GAAGTTATCAGTCGACATGGGTTGGTCACCGCTGATGATAAGGTATCTGG
CATTCCTCTTCAATTTTCTTTGTGCGGTCCTGGGCATCGCCACTATTGTG
GTCAATGTAATAGCAATCGATCAAATAGCTCCAAAGGACCAACTCATCCT
GGGACTGTACATTGCCGTTGGGTCCATCGTCTTCTTGCTCTCATTTTTTG
GATGCTTTGGTGCCATTAAGGAGAGCATCTGTGTTACCTGGGCGTATGCC
ACCTCGATGCTGGTAATGCTGATCGTCTCAATAGTCATGCTTTTTGTCTT
CCGTATGCATTTCGAAGAAGACTCCATTACCAAGCTGAAACAAGCCTTTG
CCAAGCAGACAAACACTTTCGACGCAATGGCCGAGTACCAGACACAGTAC
CAGTGCTGTGGCATATACAAGTTAAAGGACTATGGAGACGCCTACATAAC
TGTTCCAAGTAGCTGTTATGACCAAAATGATACGCCCTACAGAGACGGTT
GTCTGGCCAAAATGGAGACCCAGTACGAGGAGCTCCTCAAGGGTCCTAAG
ATTGTTGGCTGGATGCTGATGGTCATTGAGATAGGTGCCTTCACTTTCTC
CACAATCATGGGAGTGTCCTTAAGGAACGAACTACGACGCTCTGCGTATG
CAAGCTTTCTAGACCAT

BO20612.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-RA 636 CG12837-PA 1..633 17..649 3165 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-RA 848 CG12837-RA 94..727 16..649 3170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7065681..7065866 395..580 930 100 Plus
2R 25286936 2R 7065131..7065299 76..244 845 100 Plus
2R 25286936 2R 7065359..7065512 244..397 770 100 Plus
2R 25286936 2R 7065922..7065992 579..649 355 100 Plus
2R 25286936 2R 7064492..7064554 16..78 315 100 Plus
Blast to na_te.dros performed 2014-11-27 14:29:17
Subject Length Description Subject Range Query Range Score Percent Strand
TART-B 10654 TART-B DM14101 10654bp Derived from U14101 (g603662) (Rel. 42, Last updated, Version 1). 1553..1592 234..196 107 77.5 Minus
TART-C 11124 TART-C TARTC 11124bp 797..836 234..196 107 77.5 Minus

BO20612.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:40:06 Download gff for BO20612.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 78..710 17..651 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:28 Download gff for BO20612.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 95..727 17..651 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:12:46 Download gff for BO20612.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp42Er-RA 95..727 17..651 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:12:46 Download gff for BO20612.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7065684..7065866 398..580 100 -> Plus
2R 7065924..7065992 581..651 97   Plus
2R 7064493..7064552 17..76 100 -> Plus
2R 7065132..7065299 77..244 100 -> Plus
2R 7065360..7065512 245..397 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:28 Download gff for BO20612.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2953189..2953371 398..580 100 -> Plus
arm_2R 2953429..2953497 581..651 97   Plus
arm_2R 2951998..2952057 17..76 100 -> Plus
arm_2R 2952637..2952804 77..244 100 -> Plus
arm_2R 2952865..2953017 245..397 100 -> Plus

BO20612.pep Sequence

Translation from 16 to 667

> BO20612.pep
MGWSPLMIRYLAFLFNFLCAVLGIATIVVNVIAIDQIAPKDQLILGLYIA
VGSIVFLLSFFGCFGAIKESICVTWAYATSMLVMLIVSIVMLFVFRMHFE
EDSITKLKQAFAKQTNTFDAMAEYQTQYQCCGIYKLKDYGDAYITVPSSC
YDQNDTPYRDGCLAKMETQYEELLKGPKIVGWMLMVIEIGAFTFSTIMGV
SLRNELRRSAYASFLDH

BO20612.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp42Er-PA 211 CG12837-PA 1..211 1..211 1094 100 Plus
Tsp42Ee-PB 228 CG10106-PB 7..228 7..211 266 32.9 Plus
Tsp42Ee-PA 228 CG10106-PA 7..228 7..211 266 32.9 Plus
Tsp42Ea-PC 226 CG18817-PC 7..226 7..211 255 29.1 Plus
Tsp42Ea-PB 226 CG18817-PB 7..226 7..211 255 29.1 Plus