Clone BO20616 Report

Search the DGRC for BO20616

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:206
Well:16
Vector:pDNR-Dual
Associated Gene/TranscriptMtnB-RA
Protein status:BO20616.pep: Inserted from web
Sequenced Size:163

Clone Sequence Records

BO20616.complete Sequence

163 bp assembled on 2009-05-14

GenBank Submission: KX799338

> BO20616.complete
GAAGTTATCAGTCGACATGGTTTGCAAGGGTTGTGGAACAAACTGCCAGT
GCTCGGCCCAAAAGTGCGGGGACAACTGCGCCTGCAACAAGGATTGCCAG
TGCGTTTGCAAGAATGGGCCCAAGGACCAGTGCTGCAGCAACAAAGCAAG
CTTTCTAGACCAT

BO20616.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-RC 132 CG4312-PC 1..129 17..145 645 100 Plus
MtnB-RB 132 CG4312-PB 1..129 17..145 645 100 Plus
MtnB-RA 132 CG4312-PA 1..129 17..145 645 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-RC 456 CG4312-RC 89..217 17..145 645 100 Plus
MtnB-RB 448 CG4312-RB 217..345 17..145 645 100 Plus
MtnB-RA 320 CG4312-RA 89..217 17..145 645 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 20503341..20503448 145..38 525 99.1 Minus
3R 32079331 3R 20535108..20535202 42..136 235 83.2 Plus
3R 32079331 3R 20360450..20360525 62..137 200 84.2 Plus
Blast to na_te.dros performed on 2014-11-26 22:32:37 has no hits.

BO20616.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-14 12:40:59 Download gff for BO20616.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 70..198 17..147 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:01:32 Download gff for BO20616.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 89..217 17..147 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:03:58 Download gff for BO20616.complete
Subject Subject Range Query Range Percent Splice Strand
MtnB-RA 89..217 17..147 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:03:58 Download gff for BO20616.complete
Subject Subject Range Query Range Percent Splice Strand
3R 20503339..20503444 42..147 98 <- Minus
3R 20503506..20503530 17..41 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:01:32 Download gff for BO20616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 16329061..16329166 42..147 98 <- Minus
arm_3R 16329228..16329252 17..41 100   Minus

BO20616.pep Sequence

Translation from 16 to 163

> BO20616.pep
MVCKGCGTNCQCSAQKCGDNCACNKDCQCVCKNGPKDQCCSNKASFLDH

BO20616.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
MtnB-PC 43 CG4312-PC 1..43 1..43 271 100 Plus
MtnB-PB 43 CG4312-PB 1..43 1..43 271 100 Plus
MtnB-PA 43 CG4312-PA 1..43 1..43 271 100 Plus
MtnC-PA 43 CG5097-PA 1..43 1..43 234 81.4 Plus
MtnD-PB 44 CG33192-PB 1..43 1..43 221 79.1 Plus