Clone BO20631 Report

Search the DGRC for BO20631

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:206
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG15167-RA
Protein status:BO20631.pep: Imported from assembly
Sequenced Size:382

Clone Sequence Records

BO20631.complete Sequence

382 bp assembled on 2009-05-13

GenBank Submission: KX796172

> BO20631.complete
GAAGTTATCAGTCGACATGTCGCTGGAACTGGTACTCCAACCGCAGCCAG
AGATCTACCTATTAGCGTATGAAATGAGTGTGCCCGAAGATTCCGATGAG
GCCCTGCTTTCAGTTGTGGCCCACAAAGCCGCAGAACTTAAGGTGTGTGG
CTACATCGCGCATACGCACTGTGGCCGCAAAGTGGGCGGCGAACTGGAGG
GCAGCTCTGCTGGCCTGCAGATGATGGTCGAGTGGATGCAGGCTAGGAGC
CAGGGGAATCATCTCGGGGACGGGGAGAAGATCAAAAGCCAGATGAAGGA
GCCACGATTCTCGAAGTGGAAGCTGCAATCAGGGGCCCCCAAATACGATG
TTTTCTTCTGTTGCGCAAGCTTTCTAGACCAT

BO20631.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-RA 351 CG15167-PA 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-RA 450 CG15167-RA 53..400 17..364 1740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18740410..18740757 17..364 1740 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:13:53 has no hits.

BO20631.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:13 Download gff for BO20631.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 1..348 17..366 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:37:17 Download gff for BO20631.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 53..400 17..366 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:06:29 Download gff for BO20631.complete
Subject Subject Range Query Range Percent Splice Strand
CG15167-RA 53..400 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:06:29 Download gff for BO20631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18740410..18740757 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:37:17 Download gff for BO20631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18740410..18740757 17..366 99   Plus

BO20631.pep Sequence

Translation from 16 to 382

> BO20631.pep
MSLELVLQPQPEIYLLAYEMSVPEDSDEALLSVVAHKAAELKVCGYIAHT
HCGRKVGGELEGSSAGLQMMVEWMQARSQGNHLGDGEKIKSQMKEPRFSK
WKLQSGAPKYDVFFCCASFLDH

BO20631.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15167-PA 116 CG15167-PA 1..116 1..116 614 100 Plus