BO20714.complete Sequence
319 bp assembled on 2009-05-13
GenBank Submission: KX794976
> BO20714.complete
GAAGTTATCAGTCGACATGGCTAAGACACCGGAAAACATAGCCATCGATC
AGTTGGACAAGGATCAAATTAAGACGTTTTCCGACTTCCTAATGTCCTAC
AACAAACTGTCCGAGACGTGCTTCACAGATTGCATACGCGACTTTACAAC
GCGGGATGTTAAGGATTCCGAGGAGAAGTGCTCGCTGAACTGCATGGAAA
AGTATCTGAAGATGAACCAACGCGTCTCGCAGCGTTTCCAGGAGTTCCAG
GTTATTGCCCACGAGAACGCACTGGCCATGGCTCAAAAGACTGGCAAACT
TGCAAGCTTTCTAGACCAT
BO20714.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:02:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-RB | 288 | CG1660-PB | 1..285 | 17..301 | 1425 | 100 | Plus |
Tim9a-RA | 288 | CG1660-PA | 1..285 | 17..301 | 1425 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:02:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-RB | 461 | CG1660-RB | 73..357 | 17..301 | 1425 | 100 | Plus |
Tim9a-RA | 516 | CG1660-RA | 128..412 | 17..301 | 1425 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:02:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 13385659..13385789 | 171..301 | 655 | 100 | Plus |
X | 23542271 | X | 13385499..13385596 | 76..173 | 490 | 100 | Plus |
X | 23542271 | X | 13385337..13385396 | 17..76 | 300 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 01:02:03 has no hits.
BO20714.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:14 Download gff for
BO20714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 88..372 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:36:59 Download gff for
BO20714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 128..412 | 17..303 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:42:43 Download gff for
BO20714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Tim9a-RA | 128..412 | 17..303 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:42:43 Download gff for
BO20714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 13385337..13385396 | 17..76 | 100 | -> | Plus |
X | 13385500..13385595 | 77..172 | 100 | -> | Plus |
X | 13385661..13385789 | 173..303 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:36:59 Download gff for
BO20714.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 13279370..13279429 | 17..76 | 100 | -> | Plus |
arm_X | 13279533..13279628 | 77..172 | 100 | -> | Plus |
arm_X | 13279694..13279822 | 173..303 | 98 | | Plus |
BO20714.pep Sequence
Translation from 16 to 319
> BO20714.pep
MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD
SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKLASFLD
H
BO20714.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Tim9a-PB | 95 | CG1660-PB | 1..95 | 1..95 | 493 | 100 | Plus |
Tim9a-PA | 95 | CG1660-PA | 1..95 | 1..95 | 493 | 100 | Plus |