Clone BO20714 Report

Search the DGRC for BO20714

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:207
Well:14
Vector:pDNR-Dual
Associated Gene/TranscriptTim9a-RA
Protein status:BO20714.pep: Imported from assembly
Sequenced Size:319

Clone Sequence Records

BO20714.complete Sequence

319 bp assembled on 2009-05-13

GenBank Submission: KX794976

> BO20714.complete
GAAGTTATCAGTCGACATGGCTAAGACACCGGAAAACATAGCCATCGATC
AGTTGGACAAGGATCAAATTAAGACGTTTTCCGACTTCCTAATGTCCTAC
AACAAACTGTCCGAGACGTGCTTCACAGATTGCATACGCGACTTTACAAC
GCGGGATGTTAAGGATTCCGAGGAGAAGTGCTCGCTGAACTGCATGGAAA
AGTATCTGAAGATGAACCAACGCGTCTCGCAGCGTTTCCAGGAGTTCCAG
GTTATTGCCCACGAGAACGCACTGGCCATGGCTCAAAAGACTGGCAAACT
TGCAAGCTTTCTAGACCAT

BO20714.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 01:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-RB 288 CG1660-PB 1..285 17..301 1425 100 Plus
Tim9a-RA 288 CG1660-PA 1..285 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-RB 461 CG1660-RB 73..357 17..301 1425 100 Plus
Tim9a-RA 516 CG1660-RA 128..412 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 01:02:02
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13385659..13385789 171..301 655 100 Plus
X 23542271 X 13385499..13385596 76..173 490 100 Plus
X 23542271 X 13385337..13385396 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-28 01:02:03 has no hits.

BO20714.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:37:14 Download gff for BO20714.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 88..372 17..303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 20:36:59 Download gff for BO20714.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 128..412 17..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 01:42:43 Download gff for BO20714.complete
Subject Subject Range Query Range Percent Splice Strand
Tim9a-RA 128..412 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 01:42:43 Download gff for BO20714.complete
Subject Subject Range Query Range Percent Splice Strand
X 13385337..13385396 17..76 100 -> Plus
X 13385500..13385595 77..172 100 -> Plus
X 13385661..13385789 173..303 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 20:36:59 Download gff for BO20714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13279370..13279429 17..76 100 -> Plus
arm_X 13279533..13279628 77..172 100 -> Plus
arm_X 13279694..13279822 173..303 98   Plus

BO20714.pep Sequence

Translation from 16 to 319

> BO20714.pep
MAKTPENIAIDQLDKDQIKTFSDFLMSYNKLSETCFTDCIRDFTTRDVKD
SEEKCSLNCMEKYLKMNQRVSQRFQEFQVIAHENALAMAQKTGKLASFLD
H

BO20714.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Tim9a-PB 95 CG1660-PB 1..95 1..95 493 100 Plus
Tim9a-PA 95 CG1660-PA 1..95 1..95 493 100 Plus