Clone BO20831 Report

Search the DGRC for BO20831

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:208
Well:31
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO20831.pep: Imported from assembly
Sequenced Size:379

Clone Sequence Records

BO20831.complete Sequence

379 bp assembled on 2009-05-13

> BO20831.complete
GAAGTTATCAGTCGACATGATAATGCTAATGACTCCGATGACGATGCAGA
AATGGAGAATGACAAATCAGTACAACCCCAGGATGAATACAATTCATAGT
TGCGGTTGTATGGGCGTGCGCACCTGCTTGAGCTGCGAACAGGACTTTCA
GGTAGCAAAGAGCTGCCTCGGCGAATCAGTGCTCTCTTTGATGCCCTACG
AAGTTCAACAACCGGGCAAGTACAACTTGGACTTGGTGGCCAGCTACGAA
GATGAACTATTGGCGCCTCTACTGACAGATGACCAATTTGCAACTTTTGA
GGAAATGGTGCTGCGCATACCTTTGCCAAACCTCTGCCTAATAGTTTTGT
ATGGACCAGGGGCAAGCTTTCTAGACCAT

BO20831.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 19:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 915 CG4036-PB 558..754 163..359 790 93.4 Plus
CG4036-RA 915 CG4036-PA 558..754 163..359 790 93.4 Plus
CG4036-RB 915 CG4036-PB 1..79 83..161 275 89.9 Plus
CG4036-RA 915 CG4036-PA 1..79 83..161 275 89.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 19:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-RB 950 CG4036-RB 579..775 163..359 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 631..827 163..359 790 93.4 Plus
CG4036-RA 1002 CG4036-RA 70..152 79..161 295 90.4 Plus
CG4036-RB 950 CG4036-RB 20..100 81..161 285 90.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 19:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9789367..9789617 330..80 1255 100 Minus
2L 23513712 2L 9791527..9791694 163..330 705 94.6 Plus
2L 23513712 2L 9790966..9791048 79..161 295 90.4 Plus
2L 23513712 2L 9789790..9789838 82..34 245 100 Minus
Blast to na_te.dros performed on 2014-11-27 19:57:33 has no hits.

BO20831.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:32 Download gff for BO20831.complete
Subject Subject Range Query Range Percent Splice Strand
CG18854-RC 487..509 17..39 100 -> Plus
CG18854-RC 608..929 40..363 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:04:55 Download gff for BO20831.complete
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 164..359 93   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:11:34 Download gff for BO20831.complete
Subject Subject Range Query Range Percent Splice Strand
CG4036-RA 632..827 164..359 93   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:11:34 Download gff for BO20831.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9789273..9789306 331..363 94 <- Minus
2L 9789367..9789615 82..330 100 <- Minus
2L 9789791..9789832 40..81 100 <- Minus
2L 9789931..9789953 17..39 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:04:55 Download gff for BO20831.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9789273..9789306 331..363 94 <- Minus
arm_2L 9789367..9789615 82..330 100 <- Minus
arm_2L 9789791..9789832 40..81 100 <- Minus
arm_2L 9789931..9789953 17..39 100   Minus

BO20831.pep Sequence

Translation from 16 to 379

> BO20831.pep
MIMLMTPMTMQKWRMTNQYNPRMNTIHSCGCMGVRTCLSCEQDFQVAKSC
LGESVLSLMPYEVQQPGKYNLDLVASYEDELLAPLLTDDQFATFEEMVLR
IPLPNLCLIVLYGPGASFLDH

BO20831.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG4036-PB 304 CG4036-PB 183..258 46..121 293 76.3 Plus
CG4036-PA 304 CG4036-PA 183..258 46..121 293 76.3 Plus