Clone BO20877 Report

Search the DGRC for BO20877

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:208
Well:77
Vector:pDNR-Dual
Associated Gene/Transcriptcpx-RU
Protein status:BO20877.pep: Imported from assembly
Sequenced Size:463

Clone Sequence Records

BO20877.complete Sequence

463 bp assembled on 2009-05-13

GenBank Submission: KX797799

> BO20877.complete
GAAGTTATCAGTCGACATGGCGGCCTTCATAGCTAAGCAGATGGTTGGAA
ACCAATTAAGTGCCGTTAAAGATGCTGCAGGCGGAGGTGATGGAGGCGAT
GATGGCGACGACAAGGAAAAGGCAGAGGAGGAGGAGAGGGAGCGTCAGGA
GGCCATCAAGGAGGCCGAGGACCGCCGAAAGGAAAAGCACCGGAAAATGG
AGGAGGAGCGCGAGAAGATGAGGCAAGACATTCGCGATAAGTACAACATC
AAGAAGAAGGAGGAGATCGTGGAGGCGGCCCCCCAAGAAGAGCCCAATCC
CCTGATGCGGAAAAAGAAGACGCCCGAGGAACTCGCCGCCGAAGCGGAGC
AGGAAGAGCTCGACGATTTTACAAAACTGAAAAATCAAATAGAAACGCAA
GTAAATGAGCTAAAAACTCAAATAGAGGGAAAATGTGTCATGCAGGCAAG
CTTTCTAGACCAT

BO20877.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RY 432 CG32490-PY 1..429 17..445 2145 100 Plus
cpx-RU 432 CG32490-PU 1..429 17..445 2145 100 Plus
cpx-RX 429 CG32490-PX 1..426 17..445 2020 98.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RY 3544 CG32490-RY 337..765 17..445 2145 100 Plus
cpx-RU 5137 CG32490-RU 726..1154 17..445 2145 100 Plus
cpx-RX 8078 CG32490-RX 607..1032 17..445 2020 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4295128..4295286 83..241 795 100 Plus
3R 32079331 3R 4295566..4295700 240..374 675 100 Plus
3R 32079331 3R 4297480..4297558 367..445 380 98.7 Plus
3R 32079331 3R 4284352..4284406 17..71 275 100 Plus
Blast to na_te.dros performed on 2014-11-26 22:12:00 has no hits.

BO20877.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:16 Download gff for BO20877.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RN 389..805 17..447 96   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:50:06 Download gff for BO20877.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RU 560..988 17..447 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:54:03 Download gff for BO20877.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RU 726..1154 17..447 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:54:03 Download gff for BO20877.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4297488..4297558 375..447 97   Plus
3R 4295568..4295700 242..374 100 -> Plus
3R 4284352..4284406 17..71 100 -> Plus
3R 4295120..4295286 72..241 96 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:50:06 Download gff for BO20877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 121290..121422 242..374 100 -> Plus
arm_3R 123210..123280 375..447 97   Plus
arm_3R 110074..110128 17..71 100 -> Plus
arm_3R 120842..121008 72..241 96 -> Plus

BO20877.pep Sequence

Translation from 16 to 463

> BO20877.pep
MAAFIAKQMVGNQLSAVKDAAGGGDGGDDGDDKEKAEEEERERQEAIKEA
EDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKK
KTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQASFLDH

BO20877.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-PY 143 CG32490-PY 1..143 1..143 725 100 Plus
cpx-PU 143 CG32490-PU 1..143 1..143 725 100 Plus
cpx-PS 146 CG32490-PS 1..146 1..143 711 97.9 Plus
cpx-PX 142 CG32490-PX 1..142 1..143 696 97.9 Plus
cpx-PV 142 CG32490-PV 1..142 1..143 696 97.9 Plus