BO20877.complete Sequence
463 bp assembled on 2009-05-13
GenBank Submission: KX797799
> BO20877.complete
GAAGTTATCAGTCGACATGGCGGCCTTCATAGCTAAGCAGATGGTTGGAA
ACCAATTAAGTGCCGTTAAAGATGCTGCAGGCGGAGGTGATGGAGGCGAT
GATGGCGACGACAAGGAAAAGGCAGAGGAGGAGGAGAGGGAGCGTCAGGA
GGCCATCAAGGAGGCCGAGGACCGCCGAAAGGAAAAGCACCGGAAAATGG
AGGAGGAGCGCGAGAAGATGAGGCAAGACATTCGCGATAAGTACAACATC
AAGAAGAAGGAGGAGATCGTGGAGGCGGCCCCCCAAGAAGAGCCCAATCC
CCTGATGCGGAAAAAGAAGACGCCCGAGGAACTCGCCGCCGAAGCGGAGC
AGGAAGAGCTCGACGATTTTACAAAACTGAAAAATCAAATAGAAACGCAA
GTAAATGAGCTAAAAACTCAAATAGAGGGAAAATGTGTCATGCAGGCAAG
CTTTCTAGACCAT
BO20877.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:12:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RY | 432 | CG32490-PY | 1..429 | 17..445 | 2145 | 100 | Plus |
cpx-RU | 432 | CG32490-PU | 1..429 | 17..445 | 2145 | 100 | Plus |
cpx-RX | 429 | CG32490-PX | 1..426 | 17..445 | 2020 | 98.6 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:12:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-RY | 3544 | CG32490-RY | 337..765 | 17..445 | 2145 | 100 | Plus |
cpx-RU | 5137 | CG32490-RU | 726..1154 | 17..445 | 2145 | 100 | Plus |
cpx-RX | 8078 | CG32490-RX | 607..1032 | 17..445 | 2020 | 98.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:11:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 4295128..4295286 | 83..241 | 795 | 100 | Plus |
3R | 32079331 | 3R | 4295566..4295700 | 240..374 | 675 | 100 | Plus |
3R | 32079331 | 3R | 4297480..4297558 | 367..445 | 380 | 98.7 | Plus |
3R | 32079331 | 3R | 4284352..4284406 | 17..71 | 275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 22:12:00 has no hits.
BO20877.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:16 Download gff for
BO20877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RN | 389..805 | 17..447 | 96 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:50:06 Download gff for
BO20877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RU | 560..988 | 17..447 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:54:03 Download gff for
BO20877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
cpx-RU | 726..1154 | 17..447 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:54:03 Download gff for
BO20877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4297488..4297558 | 375..447 | 97 | | Plus |
3R | 4295568..4295700 | 242..374 | 100 | -> | Plus |
3R | 4284352..4284406 | 17..71 | 100 | -> | Plus |
3R | 4295120..4295286 | 72..241 | 96 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:50:06 Download gff for
BO20877.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 121290..121422 | 242..374 | 100 | -> | Plus |
arm_3R | 123210..123280 | 375..447 | 97 | | Plus |
arm_3R | 110074..110128 | 17..71 | 100 | -> | Plus |
arm_3R | 120842..121008 | 72..241 | 96 | -> | Plus |
BO20877.pep Sequence
Translation from 16 to 463
> BO20877.pep
MAAFIAKQMVGNQLSAVKDAAGGGDGGDDGDDKEKAEEEERERQEAIKEA
EDRRKEKHRKMEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKK
KTPEELAAEAEQEELDDFTKLKNQIETQVNELKTQIEGKCVMQASFLDH
BO20877.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:56:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
cpx-PY | 143 | CG32490-PY | 1..143 | 1..143 | 725 | 100 | Plus |
cpx-PU | 143 | CG32490-PU | 1..143 | 1..143 | 725 | 100 | Plus |
cpx-PS | 146 | CG32490-PS | 1..146 | 1..143 | 711 | 97.9 | Plus |
cpx-PX | 142 | CG32490-PX | 1..142 | 1..143 | 696 | 97.9 | Plus |
cpx-PV | 142 | CG32490-PV | 1..142 | 1..143 | 696 | 97.9 | Plus |