BO20891.complete Sequence
250 bp assembled on 2009-05-13
GenBank Submission: KX796513
> BO20891.complete
GAAGTTATCAGTCGACATGACTTCTCGCGATAATATTTTCGAGGAAAAAA
TATGCAATAGATTAGATCATTGCGTTTCTGATGTATTAATTAAAGGATGT
GGAGGCGTAATTATTGGATCTGCTGTATCTTTCTTAATTTTAAAGAGACG
AGCATGGCCTGTATGGCTCGGCGCTGGATTTGGAATGGGCATCGCTTATA
GGACGTGTGAAAAGGATTTAAATTCTTTAAAAGCAAGCTTTCTAGACCAT
BO20891.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:52
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG41128-RB | 219 | CG41128-PB | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:54
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG41128-RB | 364 | CG41128-RB | 96..311 | 17..232 | 1080 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:53:51
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 3752167..3752300 | 99..232 | 670 | 100 | Plus |
| 3R | 32079331 | 3R | 3750458..3750542 | 17..101 | 425 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 10:53:52 has no hits.
BO20891.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:48 Download gff for
BO20891.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG41128-RA | 41..252 | 17..228 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:43:02 Download gff for
BO20891.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG41128-RB | 53..264 | 17..228 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:33:36 Download gff for
BO20891.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG41128-RB | 96..307 | 17..228 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:33:36 Download gff for
BO20891.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 3750458..3750539 | 17..98 | 100 | -> | Plus |
| 3R | 3752167..3752296 | 99..228 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:43:02 Download gff for
BO20891.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3RHet | 1806585..1806714 | 99..228 | 100 | <- | Minus |
| 3RHet | 1808342..1808423 | 17..98 | 100 | | Minus |
BO20891.pep Sequence
Translation from 16 to 250
> BO20891.pep
MTSRDNIFEEKICNRLDHCVSDVLIKGCGGVIIGSAVSFLILKRRAWPVW
LGAGFGMGIAYRTCEKDLNSLKASFLDH
BO20891.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:57:30
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG41128-PB | 72 | CG41128-PB | 1..72 | 1..72 | 385 | 100 | Plus |
| CG12479-PA | 74 | CG12479-PA | 6..69 | 9..72 | 218 | 54.7 | Plus |
| CG13564-PA | 81 | CG13564-PA | 27..79 | 17..69 | 141 | 45.3 | Plus |
