Clone BO20894 Report

Search the DGRC for BO20894

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:208
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG14823-RB
Protein status:BO20894.pep: Imported from assembly
Sequenced Size:382

Clone Sequence Records

BO20894.complete Sequence

382 bp assembled on 2009-05-13

GenBank Submission: KX796037

> BO20894.complete
GAAGTTATCAGTCGACATGGAGCCCACATGCAGCAGCAGTGTGGCGGAAT
TGGCCAAATACAGTGAGGATGATGTGGAAACGGATGAGTCCAAGGTGGTG
GAGCATCAGGAATATGCCGAAGCGCTGTCAATGTCCGGGGAAAGTCGTAA
GCGGAAACGATGGACTCGAAGGTCCTGCTGCACTCGCCAAGTCCTGAGTA
CGGGCGCCATTTTCATCGCCCTTCTGCTCATCATCGGCGCCATTTACATG
CACTTAAGACAGAAGCATCATCTGGGCCGACTGCACATCAATCTCAAGGA
TCGGGGGCAAGTGGAGGTCCTGGAGGAGGACTTTCCCATGGTCACCGCTG
CGGGAGTGGCTGACGCAAGCTTTCTAGACCAT

BO20894.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 20:27:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-RB 351 CG14823-PB 1..348 17..364 1740 100 Plus
CG14823-RD 390 CG14823-PD 1..347 17..363 1720 99.7 Plus
CG14823-RA 792 CG14823-PA 1..343 17..359 1715 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 20:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-RB 974 CG14823-RB 66..418 12..364 1750 99.7 Plus
CG14823-RD 1108 CG14823-RD 66..417 12..363 1730 99.4 Plus
CG14823-RA 2098 CG14823-RA 66..413 12..359 1725 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 20:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7066379..7066730 12..363 1730 99.4 Plus
Blast to na_te.dros performed on 2014-11-27 20:27:08 has no hits.

BO20894.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:38:46 Download gff for BO20894.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RC 71..418 17..366 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 19:07:50 Download gff for BO20894.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RB 71..418 17..366 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 21:21:41 Download gff for BO20894.complete
Subject Subject Range Query Range Percent Splice Strand
CG14823-RB 71..418 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 21:21:41 Download gff for BO20894.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7066384..7066731 17..366 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 19:07:50 Download gff for BO20894.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7059484..7059831 17..366 99   Plus

BO20894.pep Sequence

Translation from 16 to 382

> BO20894.pep
MEPTCSSSVAELAKYSEDDVETDESKVVEHQEYAEALSMSGESRKRKRWT
RRSCCTRQVLSTGAIFIALLLIIGAIYMHLRQKHHLGRLHINLKDRGQVE
VLEEDFPMVTAAGVADASFLDH

BO20894.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 00:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14823-PB 116 CG14823-PB 1..116 1..116 592 100 Plus
CG14823-PD 129 CG14823-PD 1..118 1..118 585 96.6 Plus
CG14823-PA 263 CG14823-PA 1..114 1..114 582 100 Plus