Clone BO20937 Report

Search the DGRC for BO20937

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:209
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG8960-RB
Protein status:BO20937.pep: full length peptide match
Sequenced Size:319

Clone Sequence Records

BO20937.complete Sequence

319 bp assembled on 2009-05-13

GenBank Submission: KX796631

> BO20937.complete
GAAGTTATCAGTCGACATGATCTACTTGATGCGCAAGTGCCTGCAGCTCT
TCTGCATCATCGAGAACCGCGCCGTTCATCCGGCCGAGGAAGAGGAGAAG
GAGGTCAAGTTGCCGGAAAGGGAGATCCTCCAGAAGCGCCGCGGCGGCTT
CACCATCATCCCAGCTGCCATGCACCAGAGCATGCACGGCTTCGGCTACG
GCGAGGGTCACTACCAGATCTTTGTGGAGAAGAAGGAGCGTAACCTCCCA
ACCAAATCGCGCCTTAACGCGGCCACTGCTGAAGTCAAGCTGAATCCCAA
TGCAAGCTTTCTAGACCAT

BO20937.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RB 288 CG8960-PB 1..285 17..301 1425 100 Plus
CG8960-RA 345 CG8960-PA 58..342 17..301 1425 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-RB 659 CG8960-RB 167..451 17..301 1425 100 Plus
CG8960-RA 1016 CG8960-RA 524..808 17..301 1425 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2197597..2197881 17..301 1425 100 Plus
Blast to na_te.dros performed on 2014-11-27 13:43:30 has no hits.

BO20937.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 18:39:30 Download gff for BO20937.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..808 17..303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:53:32 Download gff for BO20937.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..808 17..303 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:25:07 Download gff for BO20937.complete
Subject Subject Range Query Range Percent Splice Strand
CG8960-RA 524..808 17..303 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:25:07 Download gff for BO20937.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2197597..2197881 17..303 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:53:32 Download gff for BO20937.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2197597..2197881 17..303 99   Plus

BO20937.pep Sequence

Translation from 16 to 319

> BO20937.pep
MIYLMRKCLQLFCIIENRAVHPAEEEEKEVKLPEREILQKRRGGFTIIPA
AMHQSMHGFGYGEGHYQIFVEKKERNLPTKSRLNAATAEVKLNPNASFLD
H

BO20937.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 01:02:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG8960-PB 95 CG8960-PB 1..95 1..95 498 100 Plus
CG8960-PA 114 CG8960-PA 20..114 1..95 498 100 Plus