BO21704.complete Sequence
337 bp assembled on 2009-12-07
GenBank Submission: KX795360
> BO21704.complete
GAAGTTATCAGTCGACATGGACATCTCAAAGGCACCAAATCCGCGAAAAC
TGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTTTGCATTTCTGCCCTTT
GTGTGGGCCATTAACGTTTGCTGGTTTTTCACGGAGGCCTTCCATAAGCC
ACCATTTTCGGAGCAGAGCCAAATAAAGAGATATGTTATATACTCTGCAG
TGGGGACTCTATTCTGGCTGATAGTACTAACTGCCTGGATAATAATATTC
CAGACAAATCGCACAGCCTGGGGCGCCACAGCGGACTATATGAGCTTCAT
CATACCCCTAGGCAGTGCAGCAAGCTTTCTAGACCAT
BO21704.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-RB | 306 | CG33198-PB | 1..303 | 17..319 | 1515 | 100 | Plus |
pen-2-RA | 306 | CG33198-PA | 1..303 | 17..319 | 1515 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-RB | 1181 | CG33198-RB | 182..485 | 16..319 | 1520 | 100 | Plus |
pen-2-RA | 543 | CG33198-RA | 182..485 | 16..319 | 1520 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 18277930..18278066 | 183..319 | 685 | 100 | Plus |
2R | 25286936 | 2R | 18277746..18277855 | 73..182 | 535 | 99.1 | Plus |
2R | 25286936 | 2R | 18277620..18277681 | 16..77 | 310 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 10:05:09 has no hits.
BO21704.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-08 09:38:40 Download gff for
BO21704.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 96..398 | 17..321 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:26 Download gff for
BO21704.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 183..485 | 17..321 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:36 Download gff for
BO21704.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
pen-2-RA | 183..485 | 17..321 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:36 Download gff for
BO21704.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 18277621..18277681 | 17..77 | 100 | -> | Plus |
2R | 18277751..18277855 | 78..182 | 100 | -> | Plus |
2R | 18277930..18278066 | 183..321 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:26 Download gff for
BO21704.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 14165126..14165186 | 17..77 | 100 | -> | Plus |
arm_2R | 14165256..14165360 | 78..182 | 100 | -> | Plus |
arm_2R | 14165435..14165571 | 183..321 | 98 | | Plus |
BO21704.pep Sequence
Translation from 16 to 337
> BO21704.pep
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
AASFLDH
BO21704.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:07:25
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
pen-2-PB | 101 | CG33198-PB | 1..101 | 1..101 | 548 | 100 | Plus |
pen-2-PA | 101 | CG33198-PA | 1..101 | 1..101 | 548 | 100 | Plus |