Clone BO21704 Report

Search the DGRC for BO21704

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:217
Well:4
Vector:pDNR-Dual
Associated Gene/Transcriptpen-2-RA
Protein status:BO21704.pep: Imported from assembly
Sequenced Size:337

Clone Sequence Records

BO21704.complete Sequence

337 bp assembled on 2009-12-07

GenBank Submission: KX795360

> BO21704.complete
GAAGTTATCAGTCGACATGGACATCTCAAAGGCACCAAATCCGCGAAAAC
TGGAGCTGTGTCGCAAATACTTCTTTGCTGGCTTTGCATTTCTGCCCTTT
GTGTGGGCCATTAACGTTTGCTGGTTTTTCACGGAGGCCTTCCATAAGCC
ACCATTTTCGGAGCAGAGCCAAATAAAGAGATATGTTATATACTCTGCAG
TGGGGACTCTATTCTGGCTGATAGTACTAACTGCCTGGATAATAATATTC
CAGACAAATCGCACAGCCTGGGGCGCCACAGCGGACTATATGAGCTTCAT
CATACCCCTAGGCAGTGCAGCAAGCTTTCTAGACCAT

BO21704.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:09
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-RB 306 CG33198-PB 1..303 17..319 1515 100 Plus
pen-2-RA 306 CG33198-PA 1..303 17..319 1515 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-RB 1181 CG33198-RB 182..485 16..319 1520 100 Plus
pen-2-RA 543 CG33198-RA 182..485 16..319 1520 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18277930..18278066 183..319 685 100 Plus
2R 25286936 2R 18277746..18277855 73..182 535 99.1 Plus
2R 25286936 2R 18277620..18277681 16..77 310 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:05:09 has no hits.

BO21704.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-08 09:38:40 Download gff for BO21704.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 96..398 17..321 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:15:26 Download gff for BO21704.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 183..485 17..321 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:12:36 Download gff for BO21704.complete
Subject Subject Range Query Range Percent Splice Strand
pen-2-RA 183..485 17..321 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:12:36 Download gff for BO21704.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18277621..18277681 17..77 100 -> Plus
2R 18277751..18277855 78..182 100 -> Plus
2R 18277930..18278066 183..321 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:15:26 Download gff for BO21704.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14165126..14165186 17..77 100 -> Plus
arm_2R 14165256..14165360 78..182 100 -> Plus
arm_2R 14165435..14165571 183..321 98   Plus

BO21704.pep Sequence

Translation from 16 to 337

> BO21704.pep
MDISKAPNPRKLELCRKYFFAGFAFLPFVWAINVCWFFTEAFHKPPFSEQ
SQIKRYVIYSAVGTLFWLIVLTAWIIIFQTNRTAWGATADYMSFIIPLGS
AASFLDH

BO21704.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
pen-2-PB 101 CG33198-PB 1..101 1..101 548 100 Plus
pen-2-PA 101 CG33198-PA 1..101 1..101 548 100 Plus