BO21802.complete Sequence
253 bp assembled on 2010-01-06
GenBank Submission: KX797556
> BO21802.complete
GAAGTTATCAGTCGACATGTGGTTCGAAATCCTACCTGGTGCGGTGATCA
TCACCACGCTCCTCTCGGTGCCCATATACGCCATGTACGGCCTGGACAAG
CTGATGATCGGCAATGCTTTCCGGCGCAACATGGACGAGCGTTTCAGCCG
AGTTATGTACCAGCGCGATTTCCGACTGACCGACAATCCCTACAAGATGA
ACGGTCTGGATGCCATACCGGATGAGAAAACGAACGCAAGCTTTCTAGAC
CAT
BO21802.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:18:34
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34439-RA | 222 | CG34439-PA | 1..219 | 17..235 | 1095 | 100 | Plus |
| CG34439-RB | 372 | CG34439-PB | 1..191 | 17..207 | 955 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:18:35
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34439-RA | 384 | CG34439-RA | 83..301 | 17..235 | 1095 | 100 | Plus |
| CG34439-RB | 728 | CG34439-RB | 83..273 | 17..207 | 955 | 100 | Plus |
| TppII-RD | 4641 | CG3991-RD | 38..125 | 203..116 | 440 | 100 | Minus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:18:32
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2R | 25286936 | 2R | 13158748..13158847 | 17..116 | 500 | 100 | Plus |
| 2R | 25286936 | 2R | 13159017..13159104 | 116..203 | 440 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:18:33 has no hits.
BO21802.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-01-06 09:26:03 Download gff for
BO21802.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34439-RA | 136..354 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:16:15 Download gff for
BO21802.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34439-RA | 83..301 | 17..237 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:26:24 Download gff for
BO21802.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG34439-RA | 83..301 | 17..237 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:26:24 Download gff for
BO21802.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2R | 13159017..13159103 | 116..202 | 100 | -> | Plus |
| 2R | 13159534..13159566 | 203..237 | 94 | | Plus |
| 2R | 13158748..13158846 | 17..115 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:16:15 Download gff for
BO21802.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2R | 9046253..9046351 | 17..115 | 100 | -> | Plus |
| arm_2R | 9046522..9046608 | 116..202 | 100 | -> | Plus |
| arm_2R | 9047039..9047071 | 203..237 | 94 | | Plus |
BO21802.pep Sequence
Translation from 16 to 253
> BO21802.pep
MWFEILPGAVIITTLLSVPIYAMYGLDKLMIGNAFRRNMDERFSRVMYQR
DFRLTDNPYKMNGLDAIPDEKTNASFLDH
BO21802.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:02:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG34439-PA | 73 | CG34439-PA | 1..73 | 1..73 | 384 | 100 | Plus |
| CG34439-PB | 123 | CG34439-PB | 1..71 | 1..71 | 360 | 95.8 | Plus |
