Clone BO22304 Report

Search the DGRC for BO22304

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:223
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptVha14-1-RA
Protein status:BO22304.pep: Imported from assembly
Sequenced Size:406

Clone Sequence Records

BO22304.complete Sequence

406 bp assembled on 2009-12-07

GenBank Submission: KX797908

> BO22304.complete
GAAGTTATCAGTCGACATGGCTCTGCACTCGGCAATCAAGGGAAAACTGA
TCAGCGTTATCGGCGACGAGGACACCTGTGTGGGCTTTCTGCTCGGCGGA
GTGGGCGAGATCAACAAGAATCGCCATCCCAACTTTATGGTGGTCGACAA
AAATACGGCCGTCAGCGAACTGGAGGACTGTTTCAAGCGTTTCCTTAAGC
GGGACGATATCGACATCATTCTAATCAACCAGAACTGCGCCGAGCTTATT
CGTCATGTGATCGATGCCCATACGTCGCCCGTGCCCGCTGTTTTGGAGAT
TCCCTCCAAGGACCATCCGTACGACGCCAGCAAGGACTCCATTCTGCGTC
GCGCCCGCGGCATGTTCAATCCGGAGGATCTGGTGCGCGCAAGCTTTCTA
GACCAT

BO22304.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-RA 375 CG8210-PA 1..372 17..388 1860 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:12
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-RA 659 CG8210-RA 98..474 12..388 1870 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:52:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15679611..15679987 388..12 1870 99.7 Minus
Blast to na_te.dros performed on 2014-11-27 13:52:10 has no hits.

BO22304.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-12-08 09:38:26 Download gff for BO22304.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-RA 99..470 17..390 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:34:19 Download gff for BO22304.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 103..474 17..390 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:28:20 Download gff for BO22304.complete
Subject Subject Range Query Range Percent Splice Strand
Vha14-1-RA 103..474 17..390 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:28:20 Download gff for BO22304.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15679609..15679982 17..390 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:34:19 Download gff for BO22304.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11567114..11567487 17..390 99   Minus

BO22304.pep Sequence

Translation from 16 to 406

> BO22304.pep
MALHSAIKGKLISVIGDEDTCVGFLLGGVGEINKNRHPNFMVVDKNTAVS
ELEDCFKRFLKRDDIDIILINQNCAELIRHVIDAHTSPVPAVLEIPSKDH
PYDASKDSILRRARGMFNPEDLVRASFLDH

BO22304.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 06:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Vha14-1-PA 124 CG8210-PA 1..124 1..124 644 100 Plus
Vha14-2-PC 124 CG1076-PC 1..121 1..121 387 57.9 Plus
Vha14-2-PB 124 CG1076-PB 1..121 1..121 387 57.9 Plus
Vha14-2-PA 129 CG1076-PA 51..126 46..121 231 56.6 Plus