Clone BO22782 Report

Search the DGRC for BO22782

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:227
Well:82
Vector:pDNR-Dual
Associated Gene/TranscriptCG34355-RC
Protein status:BO22782.pep: Imported from assembly
Sequenced Size:481

Clone Sequence Records

BO22782.complete Sequence

481 bp assembled on 2010-01-15

GenBank Submission: KX795566

> BO22782.complete
GAAGTTATCAGTCGACATGTGGAGGAAAGCGAGCAGGTTGGTCAGGGAAA
CCACCTCGTGGAAAACGCGTCGTCAGGGACAAGCGGAAGCCCCATCAGCA
GCAGTAGCAACAATAAAACCATCGACAAGGACGAGCACGCCGATTGCCCA
CGGATTACCCATCATCATCACATGGTCGCAGCTCGCTATTGTTGCTGCTG
TTGCAGTGCTCCTGCAATGCCACGTCTGTCAAGCAGCCGGACGAGCTCCA
CCGGAACCCTACTACGGTCGCTATATTGGAGATTTTACCAACTTTGCCCA
TGGCATTAAGGGTCAAATCTACGCGGTGGACGAGTCGACGCTGTTCGTCA
AATCCTTTGCCTACGACGGCACCGGACCGGACGCCTTCTTCTGGGTGGGC
AAGACGCCAAGGCCCAGTCCCGATGGCTACATCATTCCCTATCCGGAGGA
GTACACGGGCATGGCAAGCTTTCTAGACCAT

BO22782.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 03:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34355-RF 2247 CG34355-PF 1..448 17..464 2240 100 Plus
CG34355-RB 2247 CG34355-PB 1..448 17..464 2240 100 Plus
CG34355-RE 2268 CG34355-PE 1..448 17..464 2240 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34355-RF 6414 CG34355-RF 1118..1565 17..464 2240 100 Plus
CG34355-RB 6235 CG34355-RB 939..1386 17..464 2240 100 Plus
CG34355-RE 6256 CG34355-RE 939..1386 17..464 2240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 03:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23821530..23821746 17..233 1085 100 Plus
3R 32079331 3R 23830176..23830330 309..463 775 100 Plus
3R 32079331 3R 23829955..23830034 232..311 400 100 Plus
Blast to na_te.dros performed 2014-11-28 03:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2496..2530 93..127 112 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2440..2493 82..138 107 68.4 Plus

BO22782.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-09 10:05:08 Download gff for BO22782.complete
Subject Subject Range Query Range Percent Splice Strand
CG34355-RB 1..448 17..465 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:39:28 Download gff for BO22782.complete
Subject Subject Range Query Range Percent Splice Strand
CG34355-RE 939..1386 17..465 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:46:27 Download gff for BO22782.complete
Subject Subject Range Query Range Percent Splice Strand
CG34355-RE 939..1386 17..465 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:46:27 Download gff for BO22782.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23821530..23821746 17..233 100 -> Plus
3R 23829957..23830033 234..310 100 -> Plus
3R 23830178..23830330 311..465 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:39:28 Download gff for BO22782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19647252..19647468 17..233 100 -> Plus
arm_3R 19655679..19655755 234..310 100 -> Plus
arm_3R 19655900..19656052 311..465 98   Plus

BO22782.pep Sequence

Translation from 16 to 481

> BO22782.pep
MWRKASRLVRETTSWKTRRQGQAEAPSAAVATIKPSTRTSTPIAHGLPII
ITWSQLAIVAAVAVLLQCHVCQAAGRAPPEPYYGRYIGDFTNFAHGIKGQ
IYAVDESTLFVKSFAYDGTGPDAFFWVGKTPRPSPDGYIIPYPEEYTGMA
SFLDH

BO22782.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:09:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34355-PF 748 CG34355-PF 1..149 1..149 799 100 Plus
CG34355-PB 748 CG34355-PB 1..149 1..149 799 100 Plus
CG34355-PE 755 CG34355-PE 1..149 1..149 799 100 Plus
knk-PA 689 CG6217-PA 17..110 58..154 198 37.1 Plus
Skeletor-PB 289 CG14681-PA 15..87 65..137 183 47.9 Plus