Clone BO23322 Report

Search the DGRC for BO23322

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:22
Vector:pDNR-Dual
Associated Gene/TranscriptVha16-4-RA
Protein status:BO23322.pep: Imported from assembly
Sequenced Size:499

Clone Sequence Records

BO23322.complete Sequence

499 bp assembled on 2010-03-31

GenBank Submission: KX796782

> BO23322.complete
GAAGTTATCAGTCGACATGGAGCTCTCGTTGGATGAACCGCAATGCGCAT
CCTTCTTTTGCATCCTGGGTGCCGTGTGCGCCATTGTCTTTTCGACATTG
GGAGCCGCCTACGGAACAGCGAAGGCTTCTGTGGGAATCTCTTCGATGTC
AATCAAGCATCCGCAGCTGATCATGAAGGCGATTGTTCCAGTGGTTATGG
CTGGCATTATAGCCATTTATGGACTGGTGATCGCGGTCCTGCTTGCTGGA
TCACTTAGCAGCCCCTATAGCGCCTACAAGGGTTTCCTAAACCTCAGTGC
TGGACTGGCGGTGGGAGTCTCTGGGATGGGGGCTGGAATTGCTATTGGCG
TGGTGGGCGAAGCTGGAGTCCGTGCATCTGCCCAGCAGCCAAAACTCTTT
GTGGCCATCATTTTAATATTGATATTTGCCGAGGTCTTGGGTCTGTATGG
TCTCATAGTGGCCATTTATTTGTTTTCCAAGGCAAGCTTTCTAGACCAT

BO23322.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:50:03
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-4-RA 468 CG9013-PA 1..465 17..481 2325 100 Plus
Vha16-3-RB 477 CG32090-PB 320..461 327..468 215 76.8 Plus
Vha16-3-RA 477 CG32090-PA 320..461 327..468 215 76.8 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-4-RA 567 CG9013-RA 47..511 17..481 2325 100 Plus
Vha16-3-RB 633 CG32090-RB 388..529 327..468 215 76.8 Plus
Vha16-3-RA 587 CG32090-RA 342..483 327..468 215 76.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16947714..16948178 481..17 2325 100 Minus
3L 28110227 3L 11473727..11473868 327..468 215 76.8 Plus
Blast to na_te.dros performed on 2014-11-27 01:50:02 has no hits.

BO23322.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:37 Download gff for BO23322.complete
Subject Subject Range Query Range Percent Splice Strand
CG9013-RA 1..465 17..483 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:02:59 Download gff for BO23322.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 47..511 17..483 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:32:41 Download gff for BO23322.complete
Subject Subject Range Query Range Percent Splice Strand
Vha16-4-RA 47..511 17..483 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:32:41 Download gff for BO23322.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16947712..16948178 17..483 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:02:59 Download gff for BO23322.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12835217..12835683 17..483 99   Minus

BO23322.pep Sequence

Translation from 16 to 499

> BO23322.pep
MELSLDEPQCASFFCILGAVCAIVFSTLGAAYGTAKASVGISSMSIKHPQ
LIMKAIVPVVMAGIIAIYGLVIAVLLAGSLSSPYSAYKGFLNLSAGLAVG
VSGMGAGIAIGVVGEAGVRASAQQPKLFVAIILILIFAEVLGLYGLIVAI
YLFSKASFLDH

BO23322.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:44:03
Subject Length Description Subject Range Query Range Score Percent Strand
Vha16-4-PA 155 CG9013-PA 1..155 1..155 748 100 Plus
Vha16-1-PB 159 CG3161-PB 4..159 2..155 536 67.9 Plus
Vha16-1-PA 159 CG3161-PA 4..159 2..155 536 67.9 Plus
Vha16-1-PD 159 CG3161-PD 4..159 2..155 536 67.9 Plus
Vha16-1-PC 159 CG3161-PC 4..159 2..155 536 67.9 Plus