Clone BO23325 Report

Search the DGRC for BO23325

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:25
Vector:pDNR-Dual
Associated Gene/TranscriptCG14104-RB
Protein status:BO23325.pep: Imported from assembly
Sequenced Size:238

Clone Sequence Records

BO23325.complete Sequence

238 bp assembled on 2010-03-31

GenBank Submission: KX798624

> BO23325.complete
GAAGTTATCAGTCGACATGAAAGAAAATAAGAAAAAGTCGCGCAAAACGG
CCAATAAGACAAATGAAACGTCAGAGGGTCAGAAAAAGAAGATCATTGAA
CTGCTGCACGAGTACAACGACCTAAAGGATGCCACCCAGCGCGTCCTGGA
AGCCTTGGCCAACCTAAAATGCGTACCCGTCGGATCGGTTTACGCTACAT
ACAACCTGCCCCGCGACGAAGCAAGCTTTCTAGACCAT

BO23325.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-RB 207 CG14104-PB 1..204 17..220 1020 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-RB 389 CG14104-RB 52..257 15..220 1030 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19806943..19807148 220..15 1030 100 Minus
Blast to na_te.dros performed 2014-11-27 01:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 3344..3373 101..73 102 86.7 Minus

BO23325.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:38 Download gff for BO23325.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 51..254 17..222 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:31 Download gff for BO23325.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 54..257 17..222 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:27 Download gff for BO23325.complete
Subject Subject Range Query Range Percent Splice Strand
CG14104-RB 54..257 17..222 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:27 Download gff for BO23325.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19806941..19807146 17..222 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:31 Download gff for BO23325.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19800041..19800246 17..222 99   Minus

BO23325.pep Sequence

Translation from 16 to 238

> BO23325.pep
MKENKKKSRKTANKTNETSEGQKKKIIELLHEYNDLKDATQRVLEALANL
KCVPVGSVYATYNLPRDEASFLDH

BO23325.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG14104-PB 68 CG14104-PB 1..68 1..68 347 100 Plus