BO23325.complete Sequence
238 bp assembled on 2010-03-31
GenBank Submission: KX798624
> BO23325.complete
GAAGTTATCAGTCGACATGAAAGAAAATAAGAAAAAGTCGCGCAAAACGG
CCAATAAGACAAATGAAACGTCAGAGGGTCAGAAAAAGAAGATCATTGAA
CTGCTGCACGAGTACAACGACCTAAAGGATGCCACCCAGCGCGTCCTGGA
AGCCTTGGCCAACCTAAAATGCGTACCCGTCGGATCGGTTTACGCTACAT
ACAACCTGCCCCGCGACGAAGCAAGCTTTCTAGACCAT
BO23325.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:46:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14104-RB | 207 | CG14104-PB | 1..204 | 17..220 | 1020 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:46:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14104-RB | 389 | CG14104-RB | 52..257 | 15..220 | 1030 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:46:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 19806943..19807148 | 220..15 | 1030 | 100 | Minus |
Blast to na_te.dros performed 2014-11-27 01:46:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmir\worf | 4174 | Dmir\worf WORF 4174bp Derived from AY144572. | 3344..3373 | 101..73 | 102 | 86.7 | Minus |
BO23325.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:38 Download gff for
BO23325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14104-RB | 51..254 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:01:31 Download gff for
BO23325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14104-RB | 54..257 | 17..222 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:31:27 Download gff for
BO23325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14104-RB | 54..257 | 17..222 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:31:27 Download gff for
BO23325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19806941..19807146 | 17..222 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:01:31 Download gff for
BO23325.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 19800041..19800246 | 17..222 | 99 | | Minus |
BO23325.pep Sequence
Translation from 16 to 238
> BO23325.pep
MKENKKKSRKTANKTNETSEGQKKKIIELLHEYNDLKDATQRVLEALANL
KCVPVGSVYATYNLPRDEASFLDH
BO23325.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:44:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14104-PB | 68 | CG14104-PB | 1..68 | 1..68 | 347 | 100 | Plus |