BO23334.complete Sequence
268 bp assembled on 2010-03-31
GenBank Submission: KX799015
> BO23334.complete
GAAGTTATCAGTCGACATGAAGCTGCTGATTCTTCTTTTTGTTTTCATCG
CTCTTGCAAGCAATTCTTTGGCTCTGAAAAATGAAATCTGTGGATTACCC
GCTGCCGCTAATGGTAATTGCTTGGCATTGTTTTCTCGCTGGTCTTATGA
TGCTCAATATAACGTATGCTTTAATTTTATCTACGGCGGATGTCAGGGCA
ACGAAAATTCATTTGAATCCCAGGAAGAGTGTATAAATAAGTGCGTGGAG
GCAAGCTTTCTAGACCAT
BO23334.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:00:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-RC | 237 | CG31779-PC | 1..234 | 17..250 | 1170 | 100 | Plus |
| Acp24A4-RB | 237 | CG31779-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:00:44
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-RC | 653 | CG31779-RC | 41..279 | 12..250 | 1180 | 99.6 | Plus |
| Acp24A4-RB | 342 | CG31779-RB | 25..263 | 12..250 | 1180 | 99.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:00:41
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 2L | 23513712 | 2L | 3693558..3693725 | 250..83 | 840 | 100 | Minus |
| 2L | 23513712 | 2L | 3693794..3693865 | 83..12 | 345 | 98.6 | Minus |
| 2L | 23513712 | 2L | 3694108..3694275 | 250..83 | 285 | 78 | Minus |
Blast to na_te.dros performed on 2014-11-27 14:00:42 has no hits.
BO23334.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:43 Download gff for
BO23334.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..263 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:03 Download gff for
BO23334.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..263 | 17..252 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:31:56 Download gff for
BO23334.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Acp24A4-RB | 30..263 | 17..252 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:31:56 Download gff for
BO23334.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 2L | 3693556..3693724 | 84..252 | 98 | <- | Minus |
| 2L | 3693794..3693860 | 17..83 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:03 Download gff for
BO23334.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_2L | 3693556..3693724 | 84..252 | 98 | <- | Minus |
| arm_2L | 3693794..3693860 | 17..83 | 100 | | Minus |
BO23334.pep Sequence
Translation from 16 to 268
> BO23334.pep
MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLALFSRWSYDAQYNV
CFNFIYGGCQGNENSFESQEECINKCVEASFLDH
BO23334.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:56:31
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Acp24A4-PC | 78 | CG31779-PC | 1..78 | 1..78 | 417 | 100 | Plus |
| Acp24A4-PB | 78 | CG31779-PB | 1..78 | 1..78 | 417 | 100 | Plus |
| CG16713-PA | 82 | CG16713-PA | 1..82 | 1..78 | 245 | 57.3 | Plus |
| CG16712-PB | 82 | CG16712-PB | 1..82 | 1..78 | 184 | 46.3 | Plus |
| CG16712-PA | 82 | CG16712-PA | 1..82 | 1..78 | 184 | 46.3 | Plus |
