Clone BO23337 Report

Search the DGRC for BO23337

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:37
Vector:pDNR-Dual
Associated Gene/TranscriptCG4537-RB
Protein status:BO23337.pep: Imported from assembly
Sequenced Size:325

Clone Sequence Records

BO23337.complete Sequence

325 bp assembled on 2010-03-31

GenBank Submission: KX799860

> BO23337.complete
GAAGTTATCAGTCGACATGGTTTGCGAGAAGTGCGAGGCCAAGCTCTCCA
AAGTTTCAGCGCCCAATCCCTGGCGAACGAGCACAGCTCCTGCGGGAGGA
CGTAAAATCAACGAGAACAAGGCTTTATCCTCGGCCCGCGAGCGATACAA
TCCCATAGGGACTGCTTTACCACCTTGCCGAATCTGCCGACAGAAAGTGC
ACCAGATGGGTTCGCACTATTGCCAGGCGTGCGCCTACAAAAAGGCCATA
TGCGCCATGTGCGGCAAGAAGATCATGAACACCAAGAACTACAAGCAGAG
CTCAACGGCAAGCTTTCTAGACCAT

BO23337.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-RB 294 CG4537-PB 1..291 17..307 1455 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-RB 393 CG4537-RB 26..316 17..307 1455 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9890910..9891073 17..180 820 100 Plus
2L 23513712 2L 9891132..9891259 180..307 640 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:01:13 has no hits.

BO23337.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:45 Download gff for BO23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..316 17..309 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:19 Download gff for BO23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..316 17..309 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:32:08 Download gff for BO23337.complete
Subject Subject Range Query Range Percent Splice Strand
CG4537-RB 26..316 17..309 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:32:08 Download gff for BO23337.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9890910..9891073 17..180 100 -> Plus
2L 9891133..9891259 181..309 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:19 Download gff for BO23337.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9890910..9891073 17..180 100 -> Plus
arm_2L 9891133..9891259 181..309 98   Plus

BO23337.pep Sequence

Translation from 16 to 325

> BO23337.pep
MVCEKCEAKLSKVSAPNPWRTSTAPAGGRKINENKALSSARERYNPIGTA
LPPCRICRQKVHQMGSHYCQACAYKKAICAMCGKKIMNTKNYKQSSTASF
LDH

BO23337.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG4537-PB 97 CG4537-PB 1..97 1..97 530 100 Plus