Clone BO23338 Report

Search the DGRC for BO23338

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG42827-RC
Protein status:BO23338.pep: Imported from assembly
Sequenced Size:382

Clone Sequence Records

BO23338.complete Sequence

382 bp assembled on 2010-03-31

GenBank Submission: KX798430

> BO23338.complete
GAAGTTATCAGTCGACATGCGTTTGACAATCTTATGTATTTTTTGCCTGG
CAACTGTGATCCTGGCTATCGACATGGACTCGGATTCACTACAGGAACAG
TACGAAAGGGAGCAGTACAATATTCGCAAAAAAATTTGCCTTCAAAGTTC
GGAATACGGAAAGTGCAAAGGTCGTCGGAAACTTTGGTTCTACAACCCCA
AGAAATCCAAGTGTCAAGTTTTTATCTACTCGAATTGTGGTGGCAATGGC
AACCTTTTCTATACCAAGGAAAGTTGCGTGGAATTTTGTGGCAAATACGA
CTGGAAGAAGGTGCGAAAGACAGGACTTCGACGTTCAGCTGATTATAGAA
GAAAAGATGGGAATGCAAGCTTTCTAGACCAT

BO23338.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42827-RD 351 CG42827-PD 1..348 17..364 1740 100 Plus
CG42827-RC 351 CG42827-PC 1..348 17..364 1740 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG42827-RD 425 CG42827-RD 11..358 17..364 1740 100 Plus
CG42827-RC 558 CG42827-RC 144..491 17..364 1740 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23373301..23373533 132..364 1165 100 Plus
3R 32079331 3R 23373120..23373234 17..131 575 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:01:28 has no hits.

BO23338.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:46 Download gff for BO23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG6784-RB 144..491 17..366 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:25 Download gff for BO23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 144..491 17..366 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:32:11 Download gff for BO23338.complete
Subject Subject Range Query Range Percent Splice Strand
CG42827-RC 144..491 17..366 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:32:11 Download gff for BO23338.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23373301..23373533 132..366 99   Plus
3R 23373120..23373234 17..131 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:25 Download gff for BO23338.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19198842..19198956 17..131 100 -> Plus
arm_3R 19199023..19199255 132..366 99   Plus

BO23338.pep Sequence

Translation from 16 to 382

> BO23338.pep
MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC
KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR
KTGLRRSADYRRKDGNASFLDH

BO23338.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42827-PD 116 CG42827-PD 1..116 1..116 636 100 Plus
CG42827-PC 116 CG6784-PB 1..116 1..116 636 100 Plus
CG42828-PB 89 CG42828-PB 24..78 37..91 166 49.1 Plus
Ppn-PF 2776 CG33103-PF 2193..2247 40..94 148 40 Plus
Ppn-PG 2841 CG33103-PG 2136..2190 40..94 148 40 Plus