BO23338.complete Sequence
382 bp assembled on 2010-03-31
GenBank Submission: KX798430
> BO23338.complete
GAAGTTATCAGTCGACATGCGTTTGACAATCTTATGTATTTTTTGCCTGG
CAACTGTGATCCTGGCTATCGACATGGACTCGGATTCACTACAGGAACAG
TACGAAAGGGAGCAGTACAATATTCGCAAAAAAATTTGCCTTCAAAGTTC
GGAATACGGAAAGTGCAAAGGTCGTCGGAAACTTTGGTTCTACAACCCCA
AGAAATCCAAGTGTCAAGTTTTTATCTACTCGAATTGTGGTGGCAATGGC
AACCTTTTCTATACCAAGGAAAGTTGCGTGGAATTTTGTGGCAAATACGA
CTGGAAGAAGGTGCGAAAGACAGGACTTCGACGTTCAGCTGATTATAGAA
GAAAAGATGGGAATGCAAGCTTTCTAGACCAT
BO23338.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:01:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42827-RD | 351 | CG42827-PD | 1..348 | 17..364 | 1740 | 100 | Plus |
CG42827-RC | 351 | CG42827-PC | 1..348 | 17..364 | 1740 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:01:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42827-RD | 425 | CG42827-RD | 11..358 | 17..364 | 1740 | 100 | Plus |
CG42827-RC | 558 | CG42827-RC | 144..491 | 17..364 | 1740 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:01:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 23373301..23373533 | 132..364 | 1165 | 100 | Plus |
3R | 32079331 | 3R | 23373120..23373234 | 17..131 | 575 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-27 14:01:28 has no hits.
BO23338.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:46 Download gff for
BO23338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG6784-RB | 144..491 | 17..366 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:38:25 Download gff for
BO23338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42827-RC | 144..491 | 17..366 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:32:11 Download gff for
BO23338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42827-RC | 144..491 | 17..366 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:32:11 Download gff for
BO23338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 23373301..23373533 | 132..366 | 99 | | Plus |
3R | 23373120..23373234 | 17..131 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:38:25 Download gff for
BO23338.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 19198842..19198956 | 17..131 | 100 | -> | Plus |
arm_3R | 19199023..19199255 | 132..366 | 99 | | Plus |
BO23338.pep Sequence
Translation from 16 to 382
> BO23338.pep
MRLTILCIFCLATVILAIDMDSDSLQEQYEREQYNIRKKICLQSSEYGKC
KGRRKLWFYNPKKSKCQVFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVR
KTGLRRSADYRRKDGNASFLDH
BO23338.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:56:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42827-PD | 116 | CG42827-PD | 1..116 | 1..116 | 636 | 100 | Plus |
CG42827-PC | 116 | CG6784-PB | 1..116 | 1..116 | 636 | 100 | Plus |
CG42828-PB | 89 | CG42828-PB | 24..78 | 37..91 | 166 | 49.1 | Plus |
Ppn-PF | 2776 | CG33103-PF | 2193..2247 | 40..94 | 148 | 40 | Plus |
Ppn-PG | 2841 | CG33103-PG | 2136..2190 | 40..94 | 148 | 40 | Plus |