Clone BO23348 Report

Search the DGRC for BO23348

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptCG15023-RB
Protein status:BO23348.pep: Imported from assembly
Sequenced Size:541

Clone Sequence Records

BO23348.complete Sequence

541 bp assembled on 2010-03-31

GenBank Submission: KX797195

> BO23348.complete
GAAGTTATCAGTCGACATGAAGCTATTCATTTTGGCTACCTGTCTGCTGG
CTTTTGCAGCCGGTGATGTTTCGCATTTGCCGCTGGAACTCCTGGAGGAG
CATCATGAGCATGGCTATGGCTATGACTACCCCAAGCCGGAGATACCATT
TGTGATTACCTCGACGACGGAGCCACCACCGCCACCACCGACTTATCTGC
CACCCAAACCAGTACCCACTTACCTACCTCCTCCTCCGCCCACAACCACA
ACTACCACCACAACCACTCCGGCTCCTACTCCCGCTCCTACCTACCTTCC
TCCCCCTCCACCTACTACCACTACCACGACAACCACTCCCGCTCCCACTC
CTGCTCCCACTTACCTTCCTCCCCCACCTCCACCACCGCGTACCACTACC
ACCACCACCACTACAACCACAACGACACCTGCACCCACGCCAGTGCCCAC
GTACCTTCCACCCCCACCACCACAACCGGAACCGGGTTACCACTACGATG
TGCCCGCCCAAGAGTTCACCTTCGCAAGCTTTCTAGACCAT

BO23348.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-RD 510 CG15023-PD 1..507 17..523 2535 100 Plus
CG15023-RB 510 CG15023-PB 1..507 17..523 2535 100 Plus
CG15023-RC 507 CG15023-PC 3..504 22..523 2510 100 Plus
CG15023-RD 510 CG15023-PD 213..290 298..375 195 83.3 Plus
CG15023-RB 510 CG15023-PB 213..290 298..375 195 83.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-RD 819 CG15023-RD 186..692 17..523 2535 100 Plus
CG15023-RB 686 CG15023-RB 53..559 17..523 2535 100 Plus
CG15023-RC 683 CG15023-RC 55..556 22..523 2510 100 Plus
CG15023-RD 819 CG15023-RD 398..475 298..375 195 83.3 Plus
CG15023-RB 686 CG15023-RB 265..342 298..375 195 83.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4460749..4461253 523..19 2525 100 Minus
3L 28110227 3L 4460966..4461043 375..298 195 83.3 Minus
Blast to na_te.dros performed on 2014-11-28 08:42:00 has no hits.

BO23348.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:28:48 Download gff for BO23348.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 21..527 17..525 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:15 Download gff for BO23348.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 53..559 17..525 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:23:13 Download gff for BO23348.complete
Subject Subject Range Query Range Percent Splice Strand
CG15023-RB 53..559 17..525 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:23:13 Download gff for BO23348.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4460746..4461254 17..525 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:15 Download gff for BO23348.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4460746..4461254 17..525 99   Minus

BO23348.pep Sequence

Translation from 16 to 541

> BO23348.pep
MKLFILATCLLAFAAGDVSHLPLELLEEHHEHGYGYDYPKPEIPFVITST
TEPPPPPPTYLPPKPVPTYLPPPPPTTTTTTTTTPAPTPAPTYLPPPPPT
TTTTTTTPAPTPAPTYLPPPPPPPRTTTTTTTTTTTTPAPTPVPTYLPPP
PPQPEPGYHYDVPAQEFTFASFLDH

BO23348.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:57:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15023-PD 169 CG15023-PD 1..169 1..169 965 100 Plus
CG15023-PB 169 CG15023-PB 1..169 1..169 965 100 Plus
CG15023-PC 168 CG15023-PC 2..168 3..169 955 100 Plus
CG11345-PA 242 CG11345-PA 1..186 1..166 295 39.2 Plus
CG15021-PA 420 CG15021-PA 7..196 5..165 268 34 Plus