Clone BO23350 Report

Search the DGRC for BO23350

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:50
Vector:pDNR-Dual
Associated Gene/TranscriptCG30051-RC
Protein status:BO23350.pep: Imported from assembly
Sequenced Size:487

Clone Sequence Records

BO23350.complete Sequence

487 bp assembled on 2010-03-31

GenBank Submission: KX799118

> BO23350.complete
GAAGTTATCAGTCGACATGCACCCAGGGCAAATTGAGGTCAACGAGATCA
ATGGCTATTGGACATTTCTGCTGAGCATCGATTGGAAGGATCCCTGGCTT
ATTGGCCTTATTTTGGCGCATATCTTAACCACCACCACTGCGCTGCTCAG
CCGGAACAGCTCCAACTTCCAGGTTTTCCTCTTCCTAGTACTGTTGCTGG
CAGTCTACTTCACCGAAAGCATCAATGAGTTCGCTGCTAACAACTGGAGT
TCCTTTTCCAGACAACAATACTTCGATAGCAACGGCCTGTTTATCTCGAC
AGTTTTCTCAATACCTATTTTGCTTAATTGCATGCTTTTGATTGGCACTT
GGCTCTACAACTCCACGCAGCTGATGGTGACTCTAAAAACAGCGCAGCTC
AAGGAGCGAGCTCGCAAGGAACGCCAGACTAAGGCGGATTCGGAATCCAT
AGCACATAAAAAGGCAGAGGCAAGCTTTCTAGACCAT

BO23350.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 08:42:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-RC 456 CG30051-PC 1..453 17..469 2265 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 08:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-RC 676 CG30051-RC 78..530 17..469 2265 100 Plus
DUBAI-RB 4024 CG8830-RB 1..64 258..195 320 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 08:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12436514..12436663 195..344 750 100 Plus
2R 25286936 2R 12436719..12436844 344..469 630 100 Plus
2R 25286936 2R 12436321..12436438 77..194 590 100 Plus
2R 25286936 2R 12436197..12436256 17..76 300 100 Plus
Blast to na_te.dros performed on 2014-11-28 08:42:08 has no hits.

BO23350.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:28:50 Download gff for BO23350.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 101..553 17..471 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 22:26:18 Download gff for BO23350.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 78..530 17..471 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 09:23:17 Download gff for BO23350.complete
Subject Subject Range Query Range Percent Splice Strand
CG30051-RC 78..530 17..471 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 09:23:17 Download gff for BO23350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12436197..12436256 17..76 100 -> Plus
2R 12436321..12436438 77..194 100 -> Plus
2R 12436514..12436662 195..343 100 -> Plus
2R 12436719..12436844 344..471 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 22:26:18 Download gff for BO23350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8323826..8323943 77..194 100 -> Plus
arm_2R 8324019..8324167 195..343 100 -> Plus
arm_2R 8324224..8324349 344..471 98   Plus
arm_2R 8323702..8323761 17..76 100 -> Plus

BO23350.pep Sequence

Translation from 16 to 487

> BO23350.pep
MHPGQIEVNEINGYWTFLLSIDWKDPWLIGLILAHILTTTTALLSRNSSN
FQVFLFLVLLLAVYFTESINEFAANNWSSFSRQQYFDSNGLFISTVFSIP
ILLNCMLLIGTWLYNSTQLMVTLKTAQLKERARKERQTKADSESIAHKKA
EASFLDH

BO23350.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG30051-PC 151 CG30051-PC 1..151 1..151 777 100 Plus