Clone BO23368 Report

Search the DGRC for BO23368

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:68
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO23368.pep: Imported from assembly
Sequenced Size:481

Clone Sequence Records

BO23368.complete Sequence

481 bp assembled on 2010-03-31

> BO23368.complete
GAAGTTATCAGTCGACATGAAAGCAAGCTTATTTGAAGCTAAAATCGAAC
GTCTGGGGCGTTCAGATTACGGACTTTCGGCCATCTTAGAGTGGAAATAT
GACACGAATGAGGAAACGATGGTTGAGGCACAAGCGTATCGCAGTAATTC
GGGCGATGAGAGTGATTACAAGCTGCTACCCTGGGCAATACCCAAACAGC
CCTTCTATGATTACATCAACACCTACTATAAGGATGTGATCTCAAAAAAC
CTCGGCTACTGCTCCAATCTACCCAAATACGAAGATAAATTTCAGCCTCC
CTGGCCAAAGAACACCTATAAGCTTGACAAGTGCAAAATCGGTGGTGATG
GATTGCCGGAAATCGCTCCGCCAGGATTCTACAAGATCGTATTCACTAAA
TTTGGTCCTGGGCAGCCAACTTGGGGTTTCACAGCCGTTTTTAAGCTGAC
TAACAAAATTTTCGCAAGCTTTCTAGACCAT

BO23368.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-RA 576 CG18536-PA 125..573 17..463 2180 99.6 Plus
CG18537-RA 567 CG18537-PA 190..341 89..240 265 78.3 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-RA 788 CG18536-RA 277..725 17..463 2180 99.6 Plus
CG18537-RA 607 CG18537-RA 207..358 89..240 265 78.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18295253..18295595 121..463 1715 100 Plus
2R 25286936 2R 18295091..18295199 17..123 480 98.2 Plus
2R 25286936 2R 18296307..18296407 140..240 205 80.2 Plus
Blast to na_te.dros performed on 2014-11-26 15:32:52 has no hits.

BO23368.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:28:08 Download gff for BO23368.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 277..725 17..465 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:54:37 Download gff for BO23368.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 277..725 17..465 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:15:24 Download gff for BO23368.complete
Subject Subject Range Query Range Percent Splice Strand
CG18536-RA 277..725 17..465 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:15:24 Download gff for BO23368.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18295091..18295197 17..121 98 -> Plus
2R 18295254..18295595 122..465 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:54:37 Download gff for BO23368.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14182596..14182702 17..121 98 -> Plus
arm_2R 14182759..14183100 122..465 99   Plus

BO23368.pep Sequence

Translation from 16 to 481

> BO23368.pep
MKASLFEAKIERLGRSDYGLSAILEWKYDTNEETMVEAQAYRSNSGDESD
YKLLPWAIPKQPFYDYINTYYKDVISKNLGYCSNLPKYEDKFQPPWPKNT
YKLDKCKIGGDGLPEIAPPGFYKIVFTKFGPGQPTWGFTAVFKLTNKIFA
SFLDH

BO23368.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG18536-PA 191 CG18536-PA 48..191 6..149 799 100 Plus
CG18537-PA 188 CG18537-PA 46..188 7..149 545 65.7 Plus
CG18539-PB 185 CG18539-PB 47..184 9..148 464 54.3 Plus
CG14502-PD 188 CG14502-PD 49..187 8..148 431 51.8 Plus
CG14502-PC 188 CG14502-PC 49..187 8..148 431 51.8 Plus