Clone BO23381 Report

Search the DGRC for BO23381

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:233
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG34107-RA
Protein status:BO23381.pep: Imported from assembly
Sequenced Size:376

Clone Sequence Records

BO23381.complete Sequence

376 bp assembled on 2010-03-31

GenBank Submission: KX795885

> BO23381.complete
GAAGTTATCAGTCGACATGTGCGAACAGTACTGTGACAAGTTTGAGACCT
TCAATCCGGAGGTTGAGTTTGCCAAGTTTCAAAAACGCAAGCCTGTCGTA
AGGACTGCCCAACTCTATGAGAATTTGCACAAGCGGGAGGATATCAAGTG
TCCCTACAGCTTCAAAGGTTATGGCGTGGAGACGGATTCCAATACAATGT
ACCGCACTTGCAACTCCGAATATGGTTACTATGCACCCAATGCCTATACC
ATACCCAAGCGTTTCTATCCATTGCCCCAGAGTTTCTCCAATGAAGTCGT
GCGTTTCGGCATGTATCGCAATTTCTCCCTGAACACACATATGGATCGTA
CCTTCTATGCAAGCTTTCTAGACCAT

BO23381.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:37:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-RA 345 CG34107-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-RA 611 CG34107-RA 58..399 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10225173..10225375 156..358 1015 100 Plus
3R 32079331 3R 10224966..10225104 17..155 695 100 Plus
Blast to na_te.dros performed on 2014-11-26 15:37:35 has no hits.

BO23381.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:28:21 Download gff for BO23381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..399 17..360 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:55:33 Download gff for BO23381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..399 17..360 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:17:08 Download gff for BO23381.complete
Subject Subject Range Query Range Percent Splice Strand
CG34107-RA 58..399 17..360 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:17:08 Download gff for BO23381.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10225173..10225375 156..360 99   Plus
3R 10224966..10225104 17..155 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:55:33 Download gff for BO23381.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6050688..6050826 17..155 100 -> Plus
arm_3R 6050895..6051097 156..360 99   Plus

BO23381.pep Sequence

Translation from 16 to 376

> BO23381.pep
MCEQYCDKFETFNPEVEFAKFQKRKPVVRTAQLYENLHKREDIKCPYSFK
GYGVETDSNTMYRTCNSEYGYYAPNAYTIPKRFYPLPQSFSNEVVRFGMY
RNFSLNTHMDRTFYASFLDH

BO23381.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 05:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34107-PA 114 CG34107-PA 1..114 1..114 634 100 Plus