Clone BO23531 Report

Search the DGRC for BO23531

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:235
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL54-RA
Protein status:BO23531.pep: Imported from assembly
Sequenced Size:430

Clone Sequence Records

BO23531.complete Sequence

430 bp assembled on 2010-04-13

GenBank Submission: KX798862

> BO23531.complete
GAAGTTATCAGTCGACATGACCAGCCTAACCGCAGTTTTCCAGATGGCGA
GGCAGCGATTGATAGCCCCAGCGATAGGAAACTGGGCACGTTTTTATGCT
GCAAAACCGGCGGCGCCAGCGGGCAAGAAGAAAAAGCTTGGCAAGCTGGG
TCCCATCATGGAGAAGAAAGTCATACCCGTGGAAACGGATGCCAACAAAT
TGGTGAACTATGTATGCGGAAGTAACTACATGAAAACAGGAGAAGATATC
AAAATTAAACCGGATTCGGAATACCCCGACTGGCTGTGGACGCTGAATAC
GGAAGGCATCGTTCCGCTGGACGAACTGGACCCCAACTCCAAGCAGTACT
GGCGCCGTCTGAGGAAACTGGCCTTGCGGCGCAACAATCAGCTGTCCAAG
CTAAAGAAGTTCGCAAGCTTTCTAGACCAT

BO23531.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:52
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-RA 399 CG9353-PA 1..396 17..412 1905 98.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-RA 682 CG9353-RA 122..520 14..412 1920 98.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21061270..21061425 257..412 735 98.1 Plus
2R 25286936 2R 21061070..21061206 117..253 670 99.3 Plus
2R 25286936 2R 21060910..21061015 14..119 530 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:32:51 has no hits.

BO23531.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:07 Download gff for BO23531.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 90..485 17..414 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:48 Download gff for BO23531.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 125..520 17..414 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:44 Download gff for BO23531.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL54-RA 125..520 17..414 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:24:44 Download gff for BO23531.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21060913..21061015 17..119 100 -> Plus
2R 21061073..21061206 120..253 99 -> Plus
2R 21061267..21061425 254..414 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:48 Download gff for BO23531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16948418..16948520 17..119 100 -> Plus
arm_2R 16948578..16948711 120..253 99 -> Plus
arm_2R 16948772..16948930 254..414 96   Plus

BO23531.pep Sequence

Translation from 16 to 430

> BO23531.pep
MTSLTAVFQMARQRLIAPAIGNWARFYAAKPAAPAGKKKKLGKLGPIMEK
KVIPVETDANKLVNYVCGSNYMKTGEDIKIKPDSEYPDWLWTLNTEGIVP
LDELDPNSKQYWRRLRKLALRRNNQLSKLKKFASFLDH

BO23531.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:17:07
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL54-PA 132 CG9353-PA 1..132 1..132 696 100 Plus