Clone BO23583 Report

Search the DGRC for BO23583

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:235
Well:83
Vector:pDNR-Dual
Associated Gene/Transcript
Protein status:BO23583.pep: Imported from assembly
Sequenced Size:304

Clone Sequence Records

BO23583.complete Sequence

304 bp assembled on 2010-04-13

> BO23583.complete
GAAGTTATCAGTCGACATGGTTCTCAGCTCTGAGCTGCTCCAGGATGCCC
TGCGGTCCAGCAACAAGCTTCTATTCGAATGCTATGGCAGCCTGATCAGA
TGCTATCAGGAGTGCGTTGAACTTCGCAAGGATAACAAGGATCGGACTAA
GAGCCAAGACTACTGGGATGCAGAGTTTGTAGGTTCTGTGATCAAGCAGC
TGGCAGAGATGGTTCGCCGCTCTCAGGAGCCTGAAAAGCTGTTAGAAGAG
AACAATTCGAAAACTGTTCGTCCTCTTGTCACTCGTGCAAGCTTTCTAGA
CCAT

BO23583.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG18273-RA 4134 CG18273-PA 318..581 16..279 1110 94.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG18273-RA 4342 CG18273-RA 419..682 16..279 1110 94.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 481233..481502 285..16 1350 100 Minus
X 23542271 X 486839..487102 279..16 1110 94.7 Minus
X 23542271 X 478950..479011 83..22 280 96.8 Minus
X 23542271 X 478840..478906 279..213 245 91 Minus
Blast to na_te.dros performed on 2014-11-27 10:22:19 has no hits.

BO23583.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:26:48 Download gff for BO23583.complete
Subject Subject Range Query Range Percent Splice Strand
CG18166-RA 247..516 17..288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:00 Download gff for BO23583.complete
Subject Subject Range Query Range Percent Splice Strand
CG18273-RA 420..682 17..279 94   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:04 Download gff for BO23583.complete
Subject Subject Range Query Range Percent Splice Strand
CG18273-RA 420..682 17..279 94   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:20:04 Download gff for BO23583.complete
Subject Subject Range Query Range Percent Splice Strand
X 481229..481501 17..288 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:00 Download gff for BO23583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 375262..375534 17..288 99   Minus

BO23583.pep Sequence

Translation from 16 to 304

> BO23583.pep
MVLSSELLQDALRSSNKLLFECYGSLIRCYQECVELRKDNKDRTKSQDYW
DAEFVGSVIKQLAEMVRRSQEPEKLLEENNSKTVRPLVTRASFLDH

BO23583.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG18273-PA 1377 CG18273-PA 107..194 1..88 400 89.8 Plus