BO23588.complete Sequence
340 bp assembled on 2010-04-13
GenBank Submission: KX796309
> BO23588.complete
GAAGTTATCAGTCGACATGTGCCAAACAATGCGTTGCATCCTGGTTGCCT
GTGTGGCCCTTGCCCTCCTAGCCGCCGGCTGCCGAGTGGAGGCGTCCAAC
TCCAGACCTCCGCGAAAGAACGATGTCAACACTATGGCTGATGCCTACAA
GTTCCTGCAGGATCTGGACACCTACTACGGCGACAGAGCCCGCGTTCGGT
TCGGAAAGCGCGGATCGCTGATGGATATCCTGAGGAATCACGAGATGGAC
AACATAAATCTAGGAAAAAATGCCAACAATGGAGGAGAATTTGCTCGCGG
TTTTAATGAGGAGGAGATATTCGCAAGCTTTCTAGACCAT
BO23588.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 15:29:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-RC | 309 | CG10342-PC | 1..306 | 17..322 | 1530 | 100 | Plus |
NPF-RB | 309 | CG10342-PB | 1..306 | 17..322 | 1530 | 100 | Plus |
NPF-RA | 309 | CG10342-PA | 1..306 | 17..322 | 1530 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 15:29:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-RC | 579 | CG10342-RC | 86..391 | 17..322 | 1530 | 100 | Plus |
NPF-RB | 518 | CG10342-RB | 25..330 | 17..322 | 1530 | 100 | Plus |
NPF-RA | 569 | CG10342-RA | 76..381 | 17..322 | 1530 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 15:29:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 16610779..16611055 | 17..293 | 1385 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-26 15:29:49 has no hits.
BO23588.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:27:28 Download gff for
BO23588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
npf-RA | 75..380 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 23:53:48 Download gff for
BO23588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
npf-RA | 76..381 | 17..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 16:14:16 Download gff for
BO23588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
NPF-RA | 76..381 | 17..324 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 16:14:16 Download gff for
BO23588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 16610779..16611054 | 17..292 | 100 | -> | Plus |
3R | 16611108..16611137 | 293..324 | 93 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 23:53:48 Download gff for
BO23588.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 12436501..12436776 | 17..292 | 100 | -> | Plus |
arm_3R | 12436830..12436859 | 293..324 | 93 | | Plus |
BO23588.pep Sequence
Translation from 16 to 340
> BO23588.pep
MCQTMRCILVACVALALLAAGCRVEASNSRPPRKNDVNTMADAYKFLQDL
DTYYGDRARVRFGKRGSLMDILRNHEMDNINLGKNANNGGEFARGFNEEE
IFASFLDH
BO23588.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
NPF-PC | 102 | CG10342-PC | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PB | 102 | CG10342-PB | 1..102 | 1..102 | 537 | 100 | Plus |
NPF-PA | 102 | CG10342-PA | 1..102 | 1..102 | 537 | 100 | Plus |