Clone BO23610 Report

Search the DGRC for BO23610

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:236
Well:10
Vector:pDNR-Dual
Associated Gene/TranscriptCG14321-RA
Protein status:BO23610.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO23610.complete Sequence

397 bp assembled on 2010-04-13

GenBank Submission: KX796088

> BO23610.complete
GAAGTTATCAGTCGACATGACGCGTCCTGCGATTTTCCTCGTTGTCTGCT
CAATAACTCTGCTTAATTCCGTCAATGGCTACAAGGAGATCCATGGAATG
AATGGCAAGCTGTTTCCGAAGGCGGCGACGTTTAATTTTCCCGAATATGC
TTACAAGGAGACCAGCAAAAATGAAATCACTTACCACGAACTGGAGGTGA
CCTGTGACCAGCACGCCCAGTGCATTGGCCTTAGTCCGGTGGGCGTGGCC
AAGATCAACTGCATCCGACAGTGCATTTCGCCATCGTGCTACCAGGACAT
CTATGCCTTCAACGAGCTGGAGGAGGGCGAAATCGACGCCAGGCTGAACT
CCTTTAAGGGATGCGTTATCCAACGCATGGCAAGCTTTCTAGACCAT

BO23610.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-RA 366 CG14321-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-RA 702 CG14321-RA 41..403 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17733876..17734082 173..379 1035 100 Plus
3R 32079331 3R 17733638..17733794 17..173 785 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:23:45 has no hits.

BO23610.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:26:49 Download gff for BO23610.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 1..363 17..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:08 Download gff for BO23610.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 41..403 17..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:20:39 Download gff for BO23610.complete
Subject Subject Range Query Range Percent Splice Strand
CG14321-RA 41..403 17..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:20:39 Download gff for BO23610.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17733638..17733793 17..172 100 -> Plus
3R 17733876..17734082 173..381 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:08 Download gff for BO23610.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13559360..13559515 17..172 100 -> Plus
arm_3R 13559598..13559804 173..381 99   Plus

BO23610.pep Sequence

Translation from 16 to 397

> BO23610.pep
MTRPAIFLVVCSITLLNSVNGYKEIHGMNGKLFPKAATFNFPEYAYKETS
KNEITYHELEVTCDQHAQCIGLSPVGVAKINCIRQCISPSCYQDIYAFNE
LEEGEIDARLNSFKGCVIQRMASFLDH

BO23610.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG14321-PA 121 CG14321-PA 1..121 1..121 647 100 Plus