BO23627.complete Sequence
301 bp assembled on 2010-04-13
GenBank Submission: KX795015
> BO23627.complete
GAAGTTATCAGTCGACATGACCAAGGGAACCACTAGTTTTGGAAAGCGCC
ACAACAAGACGCACACCATCTGTCGCCGGTGCGGCAACTCGTCGTACCAT
CTGCAGAAATCGAAGTGCTCCCAGTGCGGCTATCCTGCGGCCAAGACCCG
AAGCTTCAACTGGTCCCGAAAGGCCAAGGGTCGCAAGGCGCAGGGAACGG
GAAGGATGCGGTACCTCAAGAATCTGCGCCGTCGTTTTCGCAACGGATTG
CGTGAAGGAGGTGCCGCTAAGAAAAAAACCAACGCAAGCTTTCTAGACCA
T
BO23627.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37b-RA | 270 | CG9873-PA | 1..267 | 17..283 | 1335 | 100 | Plus |
RpL37a-RB | 282 | CG9091-PB | 1..233 | 17..249 | 265 | 74.2 | Plus |
RpL37a-RA | 282 | CG9091-PA | 1..233 | 17..249 | 265 | 74.2 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37b-RA | 422 | CG9873-RA | 106..372 | 17..283 | 1335 | 100 | Plus |
RpL37a-RB | 565 | CG9091-RB | 114..346 | 17..249 | 265 | 74.2 | Plus |
RpL37a-RA | 1296 | CG9091-RA | 114..346 | 17..249 | 265 | 74.2 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:14:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 23100107..23100373 | 283..17 | 1335 | 100 | Minus |
X | 23542271 | X | 15138989..15139115 | 145..19 | 215 | 78 | Minus |
Blast to na_te.dros performed on 2014-11-27 10:14:50 has no hits.
BO23627.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:26:27 Download gff for
BO23627.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37b-RA | 1..255 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:22 Download gff for
BO23627.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37b-RA | 106..360 | 17..271 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:51 Download gff for
BO23627.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
RpL37b-RA | 106..360 | 17..271 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:16:51 Download gff for
BO23627.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 23100119..23100373 | 17..271 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:22 Download gff for
BO23627.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18987642..18987896 | 17..271 | 100 | | Minus |
BO23627.pep Sequence
Translation from 16 to 301
> BO23627.pep
MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWS
RKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKTNASFLDH
BO23627.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:17:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
RpL37b-PA | 89 | CG9873-PA | 1..89 | 1..89 | 485 | 100 | Plus |
RpL37a-PB | 93 | CG9091-PB | 1..87 | 1..87 | 372 | 77 | Plus |
RpL37a-PA | 93 | CG9091-PA | 1..87 | 1..87 | 372 | 77 | Plus |