Clone BO23627 Report

Search the DGRC for BO23627

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:236
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptRpL37b-RA
Protein status:BO23627.pep: Imported from assembly
Sequenced Size:301

Clone Sequence Records

BO23627.complete Sequence

301 bp assembled on 2010-04-13

GenBank Submission: KX795015

> BO23627.complete
GAAGTTATCAGTCGACATGACCAAGGGAACCACTAGTTTTGGAAAGCGCC
ACAACAAGACGCACACCATCTGTCGCCGGTGCGGCAACTCGTCGTACCAT
CTGCAGAAATCGAAGTGCTCCCAGTGCGGCTATCCTGCGGCCAAGACCCG
AAGCTTCAACTGGTCCCGAAAGGCCAAGGGTCGCAAGGCGCAGGGAACGG
GAAGGATGCGGTACCTCAAGAATCTGCGCCGTCGTTTTCGCAACGGATTG
CGTGAAGGAGGTGCCGCTAAGAAAAAAACCAACGCAAGCTTTCTAGACCA
T

BO23627.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-RA 270 CG9873-PA 1..267 17..283 1335 100 Plus
RpL37a-RB 282 CG9091-PB 1..233 17..249 265 74.2 Plus
RpL37a-RA 282 CG9091-PA 1..233 17..249 265 74.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-RA 422 CG9873-RA 106..372 17..283 1335 100 Plus
RpL37a-RB 565 CG9091-RB 114..346 17..249 265 74.2 Plus
RpL37a-RA 1296 CG9091-RA 114..346 17..249 265 74.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:14:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23100107..23100373 283..17 1335 100 Minus
X 23542271 X 15138989..15139115 145..19 215 78 Minus
Blast to na_te.dros performed on 2014-11-27 10:14:50 has no hits.

BO23627.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:26:27 Download gff for BO23627.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:06:22 Download gff for BO23627.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 106..360 17..271 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:16:51 Download gff for BO23627.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37b-RA 106..360 17..271 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:16:51 Download gff for BO23627.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23100119..23100373 17..271 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:06:22 Download gff for BO23627.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18987642..18987896 17..271 100   Minus

BO23627.pep Sequence

Translation from 16 to 301

> BO23627.pep
MTKGTTSFGKRHNKTHTICRRCGNSSYHLQKSKCSQCGYPAAKTRSFNWS
RKAKGRKAQGTGRMRYLKNLRRRFRNGLREGGAAKKKTNASFLDH

BO23627.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:17:44
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37b-PA 89 CG9873-PA 1..89 1..89 485 100 Plus
RpL37a-PB 93 CG9091-PB 1..87 1..87 372 77 Plus
RpL37a-PA 93 CG9091-PA 1..87 1..87 372 77 Plus