BO23759.complete Sequence
286 bp assembled on 2010-04-13
GenBank Submission: KX795985
> BO23759.complete
GAAGTTATCAGTCGACATGCTGAATTCCCTGGACAACCTGGAGGATTGCG
AGGAGATCTACACTCGCGAGATGCACGATATGAACATTGGCGTTGGAGAA
GGAACCGTTCCATGCTGGGTGTACCTGCTGCAGAAGTACCCGGAGAACCT
ACTTAGTCTGCGCTACTTGTCCAGCTACGAGAACTCAACCACCCATCCAT
ACATTATGCGCCATCGCCGCACCCACAAGCATCCGGCCCAGGACGACCTC
ACCTACGAGGCCCAGAACGCAAGCTTTCTAGACCAT
BO23759.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:43:53
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| Tina-1-RB | 255 | CG2803-PB | 1..252 | 17..268 | 1260 | 100 | Plus |
| Tina-1-RA | 504 | CG2803-PA | 250..501 | 17..268 | 1260 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:43:55
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| Tina-1-RB | 1429 | CG2803-RB | 914..1165 | 17..268 | 1260 | 100 | Plus |
| Tina-1-RA | 914 | CG2803-RA | 399..650 | 17..268 | 1260 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:43:51
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| 2R | 25286936 | 2R | 24940889..24941055 | 268..102 | 835 | 100 | Minus |
| 2R | 25286936 | 2R | 24941122..24941207 | 102..17 | 430 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-27 07:43:52 has no hits.
BO23759.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:23:54 Download gff for
BO23759.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| Tina-1-RB | 903..1154 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:21:26 Download gff for
BO23759.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| Tina-1-RA | 399..650 | 17..270 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:16:00 Download gff for
BO23759.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| Tina-1-RA | 399..650 | 17..270 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 08:16:00 Download gff for
BO23759.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| 2R | 24940887..24941054 | 103..270 | 98 | <- | Minus |
| 2R | 24941122..24941207 | 17..102 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:21:26 Download gff for
BO23759.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
| arm_2R | 20828410..20828577 | 103..270 | 98 | <- | Minus |
| arm_2R | 20828645..20828730 | 17..102 | 100 | | Minus |
BO23759.pep Sequence
Translation from 16 to 286
> BO23759.pep
MLNSLDNLEDCEEIYTREMHDMNIGVGEGTVPCWVYLLQKYPENLLSLRY
LSSYENSTTHPYIMRHRRTHKHPAQDDLTYEAQNASFLDH
BO23759.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:13:38
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
| Tina-1-PB | 84 | CG2803-PB | 1..84 | 1..84 | 462 | 100 | Plus |
| Tina-1-PA | 167 | CG2803-PA | 84..167 | 1..84 | 462 | 100 | Plus |
| CG2811-PA | 157 | CG2811-PA | 81..157 | 1..80 | 139 | 38.8 | Plus |