Clone BO23781 Report

Search the DGRC for BO23781

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:237
Well:81
Vector:pDNR-Dual
Associated Gene/TranscriptCG13038-RA
Protein status:BO23781.pep: Imported from assembly
Sequenced Size:316

Clone Sequence Records

BO23781.complete Sequence

316 bp assembled on 2010-04-13

GenBank Submission: KX796723

> BO23781.complete
GAAGTTATCAGTCGACATGCGGCATCTGTTGCTTCTGGCCTTAGTTTACA
TGGCTCTGGTTTTGGCCAAACCGGCGACGGAGGCGCCTCGTCTGCTCATC
GATTCAGCGCCCTCAGTGGTCTCCTACCAGGGTTCCTCACAGGCCCAAAC
CCGCTTCGTCATCGCGCCCATGGGCCGATCATTGGGCTACGTGGAGCCCA
CCAATCTCAATCGAACCTTTCACACGAAGGCAACGCAGGAGGGAGGCGCC
ACCGGCTACGAGCAGCTCAATCTGAGTCCGGTCTACGTGCCGGGTAGCGC
AAGCTTTCTAGACCAT

BO23781.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-RA 285 CG13038-PA 1..282 17..298 1410 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-RA 509 CG13038-RA 165..447 16..298 1415 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 01:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16327320..16327590 298..28 1355 100 Minus
Blast to na_te.dros performed on 2014-11-27 01:55:55 has no hits.

BO23781.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:24:02 Download gff for BO23781.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 143..424 17..300 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:05:14 Download gff for BO23781.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 166..447 17..300 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:34:31 Download gff for BO23781.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 166..447 17..300 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 02:34:31 Download gff for BO23781.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16327318..16327590 28..300 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:05:14 Download gff for BO23781.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16320418..16320690 28..300 99   Minus

BO23781.pep Sequence

Translation from 16 to 316

> BO23781.pep
MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA
PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGSASFLDH

BO23781.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-PA 94 CG13038-PA 1..94 1..94 472 100 Plus