BO23788.complete Sequence
250 bp assembled on 2010-04-15
GenBank Submission: KX798894
> BO23788.complete
GAAGTTATCAGTCGACATGAGGCAATCCATAAAGCACATATTCGCACTGT
TGGTTGCCCTGGAGTGTTTAAGCCTTGGCGACACGGCGCCCATCGGTGAG
CATCCGGATCATGCCGGATGTATACGGATAACGATCATCAAGCGACCATT
GGCCACCACCACCACCACGACAACAACAACAACTACAACCACAACAACCA
CTACAACCAGAGCAACAACCACGGCCGCTGGTGCAAGCTTTCTAGACCAT
BO23788.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-RA | 219 | CG15036-PA | 1..216 | 17..232 | 1080 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-RA | 316 | CG15036-RA | 31..246 | 17..232 | 1080 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7424597..7424812 | 232..17 | 1080 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-26 22:36:04 has no hits.
BO23788.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:24:22 Download gff for
BO23788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..216 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:03:14 Download gff for
BO23788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 31..246 | 17..234 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:25 Download gff for
BO23788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 31..246 | 17..234 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:25 Download gff for
BO23788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7424595..7424812 | 17..234 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:03:14 Download gff for
BO23788.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7318628..7318845 | 17..234 | 99 | | Minus |
BO23788.pep Sequence
Translation from 16 to 250
> BO23788.pep
MRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKRPLATTTT
TTTTTTTTTTTTTTRATTTAAGASFLDH
BO23788.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:18:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-PA | 72 | CG15036-PA | 1..72 | 1..72 | 366 | 100 | Plus |