Clone BO23788 Report

Search the DGRC for BO23788

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:237
Well:88
Vector:pDNR-Dual
Associated Gene/TranscriptCG15036-RA
Protein status:BO23788.pep: Imported from assembly
Sequenced Size:250

Clone Sequence Records

BO23788.complete Sequence

250 bp assembled on 2010-04-15

GenBank Submission: KX798894

> BO23788.complete
GAAGTTATCAGTCGACATGAGGCAATCCATAAAGCACATATTCGCACTGT
TGGTTGCCCTGGAGTGTTTAAGCCTTGGCGACACGGCGCCCATCGGTGAG
CATCCGGATCATGCCGGATGTATACGGATAACGATCATCAAGCGACCATT
GGCCACCACCACCACCACGACAACAACAACAACTACAACCACAACAACCA
CTACAACCAGAGCAACAACCACGGCCGCTGGTGCAAGCTTTCTAGACCAT

BO23788.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-RA 219 CG15036-PA 1..216 17..232 1080 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-RA 316 CG15036-RA 31..246 17..232 1080 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 22:36:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7424597..7424812 232..17 1080 100 Minus
Blast to na_te.dros performed on 2014-11-26 22:36:04 has no hits.

BO23788.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:24:22 Download gff for BO23788.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..216 17..234 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:03:14 Download gff for BO23788.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 31..246 17..234 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 23:05:25 Download gff for BO23788.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 31..246 17..234 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 23:05:25 Download gff for BO23788.complete
Subject Subject Range Query Range Percent Splice Strand
X 7424595..7424812 17..234 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:03:14 Download gff for BO23788.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7318628..7318845 17..234 99   Minus

BO23788.pep Sequence

Translation from 16 to 250

> BO23788.pep
MRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKRPLATTTT
TTTTTTTTTTTTTTRATTTAAGASFLDH

BO23788.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:18:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-PA 72 CG15036-PA 1..72 1..72 366 100 Plus