BO23904.complete Sequence
424 bp assembled on 2010-04-15
GenBank Submission: KX793797
> BO23904.complete
GAAGTTATCAGTCGACATGGAAAGGAAACCAAGTATACCAAAAATCAGGC
AGGTCAGCAGTCTTGGAAGTCAATTCACTTTTCCCAATATAGCGGATCTA
TTTTGCAATGCCGTCTCCATTCACAATGACTATTGTAAATTGCATTTTAT
AAACGAAAAGTTGCAATTCCATTTAAATGGAATGTTGGAAAGTAAAGATG
CTTCAGCGATTTACTATTTTAAGCAACATATTATTCTAAACTCGGATCAA
CTGGAATCTGCATCCAAAAATTATGACATGACCTTTCATACAATAATGAG
CGACGTTGACCGATTTCGGTACCGACAATGTAACGACATCTTGGCCCCTG
GAACAAATTTTTCCGTTTTAAAGTCAAAATATAATATCATTAGAAATGAC
ATTCATGCAAGCTTTCTAGACCAT
BO23904.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:35:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17490-RF | 393 | CG17490-PF | 1..390 | 17..406 | 1950 | 100 | Plus |
CG17490-RG | 2124 | CG17490-PG | 1732..2121 | 17..406 | 1950 | 100 | Plus |
CG17490-RE | 2124 | CG17490-PE | 1732..2121 | 17..406 | 1950 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:35:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17490-RF | 2953 | CG17490-RF | 1756..2145 | 17..406 | 1950 | 100 | Plus |
CG17490-RG | 2877 | CG17490-RG | 2376..2765 | 17..406 | 1950 | 100 | Plus |
CG17490-RE | 2315 | CG17490-RE | 1814..2203 | 17..406 | 1950 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:35:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 22540043..22540324 | 17..298 | 1410 | 100 | Plus |
2L | 23513712 | 2L | 22540377..22540485 | 298..406 | 545 | 100 | Plus |
Blast to na_te.dros performed 2014-11-27 13:35:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dkoe\Gandalf | 979 | Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). | 42..82 | 179..138 | 108 | 76.2 | Minus |
BO23904.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-19 16:24:43 Download gff for
BO23904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17490-RB | 1754..2143 | 17..408 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:55 Download gff for
BO23904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17490-RA | 430..819 | 17..408 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:21:48 Download gff for
BO23904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17490-RE | 1814..2203 | 17..408 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 14:21:48 Download gff for
BO23904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 22540043..22540324 | 17..298 | 100 | -> | Plus |
2L | 22540378..22540485 | 299..408 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:55 Download gff for
BO23904.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 22432775..22433056 | 17..298 | 100 | -> | Plus |
arm_2L | 22433110..22433217 | 299..408 | 98 | | Plus |
BO23904.pep Sequence
Translation from 16 to 424
> BO23904.pep
MERKPSIPKIRQVSSLGSQFTFPNIADLFCNAVSIHNDYCKLHFINEKLQ
FHLNGMLESKDASAIYYFKQHIILNSDQLESASKNYDMTFHTIMSDVDRF
RYRQCNDILAPGTNFSVLKSKYNIIRNDIHASFLDH
BO23904.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 01:11:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17490-PF | 130 | CG17490-PF | 1..130 | 1..130 | 686 | 100 | Plus |
CG17490-PA | 130 | CG17490-PA | 1..130 | 1..130 | 686 | 100 | Plus |
CG17490-PG | 707 | CG17490-PG | 578..707 | 1..130 | 686 | 100 | Plus |
CG17490-PE | 707 | CG17490-PE | 578..707 | 1..130 | 686 | 100 | Plus |
CG17490-PD | 103 | CG17490-PD | 1..94 | 1..94 | 494 | 100 | Plus |