Clone BO24140 Report

Search the DGRC for BO24140

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:241
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG31882-RA
Protein status:BO24140.pep: Imported from assembly
Sequenced Size:397

Clone Sequence Records

BO24140.complete Sequence

397 bp assembled on 2010-05-05

GenBank Submission: KX799958

> BO24140.complete
GAAGTTATCAGTCGACATGTTAAATTTAGGTAACATTAAAAATCGATCCA
AATTCTATGATCAACAGGATGAAAACAGACTCCAAAAGCGGCGCAAGAAG
GGTGCTGCCCAATTGGATGCAAAACCATTCCCGGACGAGCCCGTAACGTC
GAGTGAGGAAAGTCTATATCCTCGGGTTAGCCGTATGCTACGTCGGATGA
GCTCTTCGCTCTGGTCACGACTTTGGGGTCTATCCAATCAATCCACTGAC
TCTGCCCGCCTGAAGACACATCCGAACGAGCTAGGCAACCAGTACCCGCC
GAGGACGGATTCGGGGCAGATCCCTCTGTGGCAGGCCAGCCCGACAGCTT
ATTTGGGATATCGTTTCCGATTGGGCAGAGCAAGCTTTCTAGACCAT

BO24140.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG31882-RA 366 CG31882-PA 1..363 17..379 1815 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG31882-RA 834 CG31882-RA 63..425 17..379 1815 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9624861..9625223 379..17 1815 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:21:30 has no hits.

BO24140.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-05 11:42:57 Download gff for BO24140.complete
Subject Subject Range Query Range Percent Splice Strand
CG31882-RA 68..425 22..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:24 Download gff for BO24140.complete
Subject Subject Range Query Range Percent Splice Strand
CG31882-RA 68..425 22..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:27:29 Download gff for BO24140.complete
Subject Subject Range Query Range Percent Splice Strand
CG31882-RA 68..425 22..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:27:29 Download gff for BO24140.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9624859..9625218 22..381 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:24 Download gff for BO24140.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9624859..9625218 22..381 99   Minus

BO24140.pep Sequence

Translation from 16 to 397

> BO24140.pep
MLNLGNIKNRSKFYDQQDENRLQKRRKKGAAQLDAKPFPDEPVTSSEESL
YPRVSRMLRRMSSSLWSRLWGLSNQSTDSARLKTHPNELGNQYPPRTDSG
QIPLWQASPTAYLGYRFRLGRASFLDH

BO24140.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG31882-PA 121 CG31882-PA 1..121 1..121 639 100 Plus