Clone BO24147 Report

Search the DGRC for BO24147

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:241
Well:47
Vector:pDNR-Dual
Associated Gene/TranscriptCG32440-RA
Protein status:BO24147.pep: Imported from assembly
Sequenced Size:289

Clone Sequence Records

BO24147.complete Sequence

289 bp assembled on 2010-05-05

GenBank Submission: KX795388

> BO24147.complete
GAAGTTATCAGTCGACATGTCATCGCAGTTTCGTGAGAAGCGCGGATTAG
CTAGCAGTGCCAATAATGAACTGCCCACCATGGATCCCAACGAGAGTGAC
TTCGCTCTGGAGCTGAAGCCAGCACCCAAACAGACCTGCATTCCGACGCA
CCAACGCCAGAGATTGGCCAGCTCGGACACCAACGTCTATCAGCGTGAGA
GCGTGTTTGATATACCGGACAAGTCCTGGTCAGTCCTGTACTTTGGATCC
GGCAAGGACAGTTCCTCGAAAGCAAGCTTTCTAGACCAT

BO24147.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-RA 258 CG32440-PA 1..255 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:22:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-RA 633 CG32440-RA 185..440 16..271 1280 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21360363..21360530 16..183 840 100 Plus
3L 28110227 3L 21360949..21361036 184..271 440 100 Plus
Blast to na_te.dros performed 2014-11-28 02:21:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 2352..2482 140..263 115 58.8 Plus

BO24147.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-05 11:43:05 Download gff for BO24147.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..440 17..273 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:17:36 Download gff for BO24147.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..440 17..273 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:27:41 Download gff for BO24147.complete
Subject Subject Range Query Range Percent Splice Strand
CG32440-RA 186..440 17..273 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:27:41 Download gff for BO24147.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21360364..21360530 17..183 100 -> Plus
3L 21360949..21361036 184..273 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:17:36 Download gff for BO24147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21353464..21353630 17..183 100 -> Plus
arm_3L 21354049..21354136 184..273 97   Plus

BO24147.pep Sequence

Translation from 16 to 289

> BO24147.pep
MSSQFREKRGLASSANNELPTMDPNESDFALELKPAPKQTCIPTHQRQRL
ASSDTNVYQRESVFDIPDKSWSVLYFGSGKDSSSKASFLDH

BO24147.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:03:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG32440-PA 85 CG32440-PA 1..85 1..85 441 100 Plus