Clone BO24508 Report

Search the DGRC for BO24508

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:8
Vector:pDNR-Dual
Associated Gene/TranscriptCG33170-RB
Protein status:BO24508.pep: Imported from assembly
Sequenced Size:247

Clone Sequence Records

BO24508.complete Sequence

247 bp assembled on 2010-05-18

GenBank Submission: KX794822

> BO24508.complete
GAAGTTATCAGTCGACATGCTCAAGTTTCTGTTAACTTTTGGCGCCGGGG
TGTATACGGGAATCTATGTCTCACAGAACTATGAGGTCCCCCGAGTGGAT
GATCCCCAGAAGTTGATGCAGCGTTTCAACGAGAAACTCAAAGAACTAAT
GGATCAAACCAAGAACAAATCGCCCGGCGAGAAACTAGTGGATGACATCA
AAAAGGAGGCCAAGAAGATACTAGACGACGCAAGCTTTCTAGACCAT

BO24508.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-RC 216 CG33170-PC 1..213 17..229 1065 100 Plus
CG33170-RB 216 CG33170-PB 1..213 17..229 1065 100 Plus
CG33170-RA 297 CG33170-PA 156..293 31..168 690 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-RC 357 CG33170-RC 70..282 17..229 1065 100 Plus
CG33170-RB 599 CG33170-RB 312..524 17..229 1065 100 Plus
CG33170-RA 842 CG33170-RA 211..348 31..168 690 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22865876..22865960 84..168 425 100 Plus
3L 28110227 3L 22867395..22867460 164..229 315 98.5 Plus
3L 28110227 3L 22865770..22865826 31..87 285 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:23 has no hits.

BO24508.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:00 Download gff for BO24508.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 312..524 17..231 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:26:38 Download gff for BO24508.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 312..524 17..231 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:21 Download gff for BO24508.complete
Subject Subject Range Query Range Percent Splice Strand
CG33170-RB 312..524 17..231 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:21 Download gff for BO24508.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22865771..22865824 32..85 100 -> Plus
3L 22865878..22865960 86..168 100 -> Plus
3L 22867400..22867460 169..231 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:26:38 Download gff for BO24508.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22858871..22858924 32..85 100 -> Plus
arm_3L 22858978..22859060 86..168 100 -> Plus
arm_3L 22860500..22860560 169..231 96   Plus

BO24508.pep Sequence

Translation from 16 to 247

> BO24508.pep
MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN
KSPGEKLVDDIKKEAKKILDDASFLDH

BO24508.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG33170-PC 71 CG33170-PC 1..71 1..71 364 100 Plus
CG33170-PB 71 CG33170-PB 1..71 1..71 364 100 Plus
CG33170-PA 98 CG33170-PA 53..98 6..51 240 100 Plus