BO24508.complete Sequence
247 bp assembled on 2010-05-18
GenBank Submission: KX794822
> BO24508.complete
GAAGTTATCAGTCGACATGCTCAAGTTTCTGTTAACTTTTGGCGCCGGGG
TGTATACGGGAATCTATGTCTCACAGAACTATGAGGTCCCCCGAGTGGAT
GATCCCCAGAAGTTGATGCAGCGTTTCAACGAGAAACTCAAAGAACTAAT
GGATCAAACCAAGAACAAATCGCCCGGCGAGAAACTAGTGGATGACATCA
AAAAGGAGGCCAAGAAGATACTAGACGACGCAAGCTTTCTAGACCAT
BO24508.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33170-RC | 216 | CG33170-PC | 1..213 | 17..229 | 1065 | 100 | Plus |
CG33170-RB | 216 | CG33170-PB | 1..213 | 17..229 | 1065 | 100 | Plus |
CG33170-RA | 297 | CG33170-PA | 156..293 | 31..168 | 690 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33170-RC | 357 | CG33170-RC | 70..282 | 17..229 | 1065 | 100 | Plus |
CG33170-RB | 599 | CG33170-RB | 312..524 | 17..229 | 1065 | 100 | Plus |
CG33170-RA | 842 | CG33170-RA | 211..348 | 31..168 | 690 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 22865876..22865960 | 84..168 | 425 | 100 | Plus |
3L | 28110227 | 3L | 22867395..22867460 | 164..229 | 315 | 98.5 | Plus |
3L | 28110227 | 3L | 22865770..22865826 | 31..87 | 285 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:45:23 has no hits.
BO24508.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:00 Download gff for
BO24508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33170-RB | 312..524 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:26:38 Download gff for
BO24508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33170-RB | 312..524 | 17..231 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:21 Download gff for
BO24508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG33170-RB | 312..524 | 17..231 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:21 Download gff for
BO24508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 22865771..22865824 | 32..85 | 100 | -> | Plus |
3L | 22865878..22865960 | 86..168 | 100 | -> | Plus |
3L | 22867400..22867460 | 169..231 | 96 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:26:38 Download gff for
BO24508.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 22858871..22858924 | 32..85 | 100 | -> | Plus |
arm_3L | 22858978..22859060 | 86..168 | 100 | -> | Plus |
arm_3L | 22860500..22860560 | 169..231 | 96 | | Plus |
BO24508.pep Sequence
Translation from 16 to 247
> BO24508.pep
MLKFLLTFGAGVYTGIYVSQNYEVPRVDDPQKLMQRFNEKLKELMDQTKN
KSPGEKLVDDIKKEAKKILDDASFLDH
BO24508.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:55:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG33170-PC | 71 | CG33170-PC | 1..71 | 1..71 | 364 | 100 | Plus |
CG33170-PB | 71 | CG33170-PB | 1..71 | 1..71 | 364 | 100 | Plus |
CG33170-PA | 98 | CG33170-PA | 53..98 | 6..51 | 240 | 100 | Plus |