Clone BO24521 Report

Search the DGRC for BO24521

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:21
Vector:pDNR-Dual
Associated Gene/TranscriptCG34175-RA
Protein status:BO24521.pep: Imported from assembly
Sequenced Size:292

Clone Sequence Records

BO24521.complete Sequence

292 bp assembled on 2010-05-18

GenBank Submission: KX797401

> BO24521.complete
GAAGTTATCAGTCGACATGGTGTGCCGCTTCAATCCCTTTTACATTGGAC
CAACTCCACCCAGCTGCTGCACGGATTTGAAGTCCGATTGCGATTGCCCG
CCGTGCTCACCGGATACAGGGTATCAGGAGCCTCGACCCGTTCACGAGGA
GTGCAACCCGGGTGTGCCGAAGAAGGAGACCAAGGAGAGCAAGTGCAATC
CTCCTTGCAAAGAAGCCCCCAAAAAGGAAAAGAAGGAGAAGAAGTCCGAG
AATAAAGAGGCTAAAAAAACTAAAGCAAGCTTTCTAGACCAT

BO24521.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-RA 261 CG34175-PA 1..258 17..274 1290 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-RA 662 CG34175-RA 113..370 17..274 1290 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3398135..3398392 17..274 1290 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:41 has no hits.

BO24521.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:04 Download gff for BO24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:26:44 Download gff for BO24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:27 Download gff for BO24521.complete
Subject Subject Range Query Range Percent Splice Strand
CG34175-RA 113..358 17..262 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:27 Download gff for BO24521.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3398135..3398380 17..262 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:26:44 Download gff for BO24521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3398135..3398380 17..262 100   Plus

BO24521.pep Sequence

Translation from 16 to 292

> BO24521.pep
MVCRFNPFYIGPTPPSCCTDLKSDCDCPPCSPDTGYQEPRPVHEECNPGV
PKKETKESKCNPPCKEAPKKEKKEKKSENKEAKKTKASFLDH

BO24521.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34175-PA 86 CG34175-PA 1..86 1..86 502 100 Plus