Clone BO24523 Report

Search the DGRC for BO24523

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:23
Vector:pDNR-Dual
Associated Gene/TranscriptCG34203-RA
Protein status:BO24523.pep: Imported from assembly
Sequenced Size:376

Clone Sequence Records

BO24523.complete Sequence

376 bp assembled on 2010-05-18

GenBank Submission: KX796412

> BO24523.complete
GAAGTTATCAGTCGACATGCGTTGCAACAAGATTATTTTCCAACTTATTG
CCTGTTTTGTGATCATTGAGCTTGTGCTCGGTTATCCCCAAGATCGTTTC
ACATCAGCGGAACAGATTCAACAACTAAGTGATGCCAATGAAGGGGATGC
TCATCCAGAGATCTCTTCCAGCAGTGAAACCCTTAGAAATTTATACAGAT
ACGAGCGCACTCTGAGCAGATTACGAAGAGCTCTGGAGGAGTTGGCCTAT
GAGGAGGCGGCCGATGATATGGAACTGGCCGAGATTAATGTTTTCCGGCC
ACTCTTCCGTTACCGATCTCAGGTGGTGAAGGTGAAGAATCCGCAGCAGC
AGTTTGGTGCAAGCTTTCTAGACCAT

BO24523.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-RA 345 CG34203-PA 1..342 17..358 1710 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-RA 535 CG34203-RA 62..403 17..358 1710 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21281195..21281523 358..30 1645 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:45:46 has no hits.

BO24523.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:05 Download gff for BO24523.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..403 17..360 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:26:47 Download gff for BO24523.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..403 17..360 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:29 Download gff for BO24523.complete
Subject Subject Range Query Range Percent Splice Strand
CG34203-RA 62..403 17..360 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:29 Download gff for BO24523.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21281193..21281521 32..360 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:26:47 Download gff for BO24523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17168698..17169026 32..360 99 <- Minus

BO24523.pep Sequence

Translation from 16 to 376

> BO24523.pep
MRCNKIIFQLIACFVIIELVLGYPQDRFTSAEQIQQLSDANEGDAHPEIS
SSSETLRNLYRYERTLSRLRRALEELAYEEAADDMELAEINVFRPLFRYR
SQVVKVKNPQQQFGASFLDH

BO24523.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34203-PA 114 CG34203-PA 1..114 1..114 575 100 Plus