Clone BO24528 Report

Search the DGRC for BO24528

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:28
Vector:pDNR-Dual
Associated Gene/TranscriptCG34172-RA
Protein status:BO24528.pep: Imported from assembly
Sequenced Size:220

Clone Sequence Records

BO24528.complete Sequence

220 bp assembled on 2010-05-18

GenBank Submission: KX795488

> BO24528.complete
GAAGTTATCAGTCGACATGGCTCTACCCGATGGACTTTCCAACAAAATGA
AGGTTTTCCAGGCCGTTAACGAGCTGCCCGTTTTTCTGAAAGGCGGACCT
GCGGATAAGATTTTATTTGGCATTACGGCTGGACTGTGTGGCCTTGGCAT
TGTTAGCTTTGTCCACCTGGTCTACACAATGGGATTCGCCAAAAAGAAGG
CCGCAAGCTTTCTAGACCAT

BO24528.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-RD 189 CG34172-PD 1..186 17..202 930 100 Plus
CG34172-RC 189 CG34172-PC 1..186 17..202 930 100 Plus
CG34172-RB 189 CG34172-PB 1..186 17..202 930 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-RD 303 CG34172-RD 68..253 17..202 930 100 Plus
CG34172-RC 866 CG34172-RC 631..816 17..202 930 100 Plus
CG34172-RB 295 CG34172-RB 60..245 17..202 930 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2192575..2192723 202..54 730 99.3 Minus
2L 23513712 2L 2192777..2192822 62..17 230 100 Minus
Blast to na_te.dros performed on 2014-11-28 02:46:46 has no hits.

BO24528.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:19 Download gff for BO24528.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RA 63..248 17..204 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:12 Download gff for BO24528.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 60..245 17..204 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:51 Download gff for BO24528.complete
Subject Subject Range Query Range Percent Splice Strand
CG34172-RB 60..245 17..204 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:51 Download gff for BO24528.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2192573..2192715 62..204 98 <- Minus
2L 2192778..2192822 17..61 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:12 Download gff for BO24528.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2192573..2192715 62..204 98 <- Minus
arm_2L 2192778..2192822 17..61 100   Minus

BO24528.pep Sequence

Translation from 16 to 220

> BO24528.pep
MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH
LVYTMGFAKKKAASFLDH

BO24528.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG34172-PD 62 CG34172-PD 1..62 1..62 317 100 Plus
CG34172-PC 62 CG34172-PC 1..62 1..62 317 100 Plus
CG34172-PB 62 CG34172-PB 1..62 1..62 317 100 Plus
CG34172-PA 62 CG34172-PA 1..62 1..62 317 100 Plus