BO24528.complete Sequence
220 bp assembled on 2010-05-18
GenBank Submission: KX795488
> BO24528.complete
GAAGTTATCAGTCGACATGGCTCTACCCGATGGACTTTCCAACAAAATGA
AGGTTTTCCAGGCCGTTAACGAGCTGCCCGTTTTTCTGAAAGGCGGACCT
GCGGATAAGATTTTATTTGGCATTACGGCTGGACTGTGTGGCCTTGGCAT
TGTTAGCTTTGTCCACCTGGTCTACACAATGGGATTCGCCAAAAAGAAGG
CCGCAAGCTTTCTAGACCAT
BO24528.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34172-RD | 189 | CG34172-PD | 1..186 | 17..202 | 930 | 100 | Plus |
CG34172-RC | 189 | CG34172-PC | 1..186 | 17..202 | 930 | 100 | Plus |
CG34172-RB | 189 | CG34172-PB | 1..186 | 17..202 | 930 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34172-RD | 303 | CG34172-RD | 68..253 | 17..202 | 930 | 100 | Plus |
CG34172-RC | 866 | CG34172-RC | 631..816 | 17..202 | 930 | 100 | Plus |
CG34172-RB | 295 | CG34172-RB | 60..245 | 17..202 | 930 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2192575..2192723 | 202..54 | 730 | 99.3 | Minus |
2L | 23513712 | 2L | 2192777..2192822 | 62..17 | 230 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 02:46:46 has no hits.
BO24528.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:19 Download gff for
BO24528.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34172-RA | 63..248 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:12 Download gff for
BO24528.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34172-RB | 60..245 | 17..204 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:51 Download gff for
BO24528.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34172-RB | 60..245 | 17..204 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:51 Download gff for
BO24528.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2192573..2192715 | 62..204 | 98 | <- | Minus |
2L | 2192778..2192822 | 17..61 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:12 Download gff for
BO24528.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2192573..2192715 | 62..204 | 98 | <- | Minus |
arm_2L | 2192778..2192822 | 17..61 | 100 | | Minus |
BO24528.pep Sequence
Translation from 16 to 220
> BO24528.pep
MALPDGLSNKMKVFQAVNELPVFLKGGPADKILFGITAGLCGLGIVSFVH
LVYTMGFAKKKAASFLDH
BO24528.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34172-PD | 62 | CG34172-PD | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PC | 62 | CG34172-PC | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PB | 62 | CG34172-PB | 1..62 | 1..62 | 317 | 100 | Plus |
CG34172-PA | 62 | CG34172-PA | 1..62 | 1..62 | 317 | 100 | Plus |