BO24531.complete Sequence
265 bp assembled on 2010-05-18
GenBank Submission: KX793911
> BO24531.complete
GAAGTTATCAGTCGACATGGCTAAATTGAGTGCCCTGCTGCTGCCCCTAA
TTTTGTTTATTGTGGCCTTTGTGGCGCACACAACTTTTGCTACAGTGCAG
CCAAAAGCACCGAACTTCCAGTACTTCGAAAGGCCCAAGTACCGTTATCC
CTACTACGATGAACACGGGCGCGGAAAACTTCTCTACGGCTACGGCGGAC
CGGAATTGTACCAATACAAGACCTACACGCCCTTGGAGGGCATTCACGCA
AGCTTTCTAGACCAT
BO24531.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34115-RA | 234 | CG34115-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34115-RA | 418 | CG34115-RA | 106..337 | 16..247 | 1160 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 20976737..20976853 | 131..247 | 585 | 100 | Plus |
2R | 25286936 | 2R | 20976595..20976681 | 47..133 | 435 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:46:51 has no hits.
BO24531.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:22 Download gff for
BO24531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34115-RA | 79..309 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:14 Download gff for
BO24531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34115-RA | 107..337 | 17..249 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:52 Download gff for
BO24531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34115-RA | 107..337 | 17..249 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:52 Download gff for
BO24531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 20976739..20976853 | 133..249 | 98 | | Plus |
2R | 20975594..20975623 | 17..46 | 100 | -> | Plus |
2R | 20976595..20976680 | 47..132 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:14 Download gff for
BO24531.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 16864244..16864358 | 133..249 | 98 | | Plus |
arm_2R | 16863099..16863128 | 17..46 | 100 | -> | Plus |
arm_2R | 16864100..16864185 | 47..132 | 100 | -> | Plus |
BO24531.pep Sequence
Translation from 16 to 265
> BO24531.pep
MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH
GRGKLLYGYGGPELYQYKTYTPLEGIHASFLDH
BO24531.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34115-PA | 77 | CG34115-PA | 1..77 | 1..77 | 418 | 100 | Plus |