Clone BO24531 Report

Search the DGRC for BO24531

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:31
Vector:pDNR-Dual
Associated Gene/TranscriptCG34115-RA
Protein status:BO24531.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO24531.complete Sequence

265 bp assembled on 2010-05-18

GenBank Submission: KX793911

> BO24531.complete
GAAGTTATCAGTCGACATGGCTAAATTGAGTGCCCTGCTGCTGCCCCTAA
TTTTGTTTATTGTGGCCTTTGTGGCGCACACAACTTTTGCTACAGTGCAG
CCAAAAGCACCGAACTTCCAGTACTTCGAAAGGCCCAAGTACCGTTATCC
CTACTACGATGAACACGGGCGCGGAAAACTTCTCTACGGCTACGGCGGAC
CGGAATTGTACCAATACAAGACCTACACGCCCTTGGAGGGCATTCACGCA
AGCTTTCTAGACCAT

BO24531.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-RA 234 CG34115-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-RA 418 CG34115-RA 106..337 16..247 1160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20976737..20976853 131..247 585 100 Plus
2R 25286936 2R 20976595..20976681 47..133 435 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:51 has no hits.

BO24531.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:22 Download gff for BO24531.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 79..309 17..249 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:14 Download gff for BO24531.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 107..337 17..249 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:52 Download gff for BO24531.complete
Subject Subject Range Query Range Percent Splice Strand
CG34115-RA 107..337 17..249 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:52 Download gff for BO24531.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20976739..20976853 133..249 98   Plus
2R 20975594..20975623 17..46 100 -> Plus
2R 20976595..20976680 47..132 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:14 Download gff for BO24531.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16864244..16864358 133..249 98   Plus
arm_2R 16863099..16863128 17..46 100 -> Plus
arm_2R 16864100..16864185 47..132 100 -> Plus

BO24531.pep Sequence

Translation from 16 to 265

> BO24531.pep
MAKLSALLLPLILFIVAFVAHTTFATVQPKAPNFQYFERPKYRYPYYDEH
GRGKLLYGYGGPELYQYKTYTPLEGIHASFLDH

BO24531.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34115-PA 77 CG34115-PA 1..77 1..77 418 100 Plus