Clone BO24533 Report

Search the DGRC for BO24533

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:33
Vector:pDNR-Dual
Associated Gene/TranscriptCG34228-RA
Protein status:BO24533.pep: Imported from assembly
Sequenced Size:298

Clone Sequence Records

BO24533.complete Sequence

298 bp assembled on 2010-05-18

GenBank Submission: KX799934

> BO24533.complete
GAAGTTATCAGTCGACATGTGGCCAATTGTTATGGCTCTAATTAGGCGTA
ACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTTTTATTGGC
TATAACATAGAGAGTTGGATATCTGACAAATACACCCCATACAGTCCATC
CATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTTGAATACAG
ATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTACTGGAACGC
AACCTCTCCCCGTCGCTACAGCCCAAGGCCGCAAGCTTTCTAGACCAT

BO24533.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-RA 267 CG34228-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-RA 415 CG34228-RA 86..349 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11652140..11652273 147..280 670 100 Plus
2R 25286936 2R 11651942..11652071 17..146 650 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:46:57 has no hits.

BO24533.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:24 Download gff for BO24533.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 66..329 17..282 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:16 Download gff for BO24533.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 86..349 17..282 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:54 Download gff for BO24533.complete
Subject Subject Range Query Range Percent Splice Strand
CG34228-RA 86..349 17..282 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:54 Download gff for BO24533.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11651942..11652071 17..146 100 -> Plus
2R 11652140..11652273 147..282 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:16 Download gff for BO24533.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7539447..7539576 17..146 100 -> Plus
arm_2R 7539645..7539778 147..282 98   Plus

BO24533.pep Sequence

Translation from 16 to 298

> BO24533.pep
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKAASFLDH

BO24533.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34228-PA 88 CG34228-PA 1..88 1..88 445 100 Plus