BO24533.complete Sequence
298 bp assembled on 2010-05-18
GenBank Submission: KX799934
> BO24533.complete
GAAGTTATCAGTCGACATGTGGCCAATTGTTATGGCTCTAATTAGGCGTA
ACGCCGTTTACATCACGTTGCCCATAGCCGGCGTTGTGGGTTTTATTGGC
TATAACATAGAGAGTTGGATATCTGACAAATACACCCCATACAGTCCATC
CATACAAGAGTTGCGCGCTAAACGGTTGACAGAAGAAAGTTTGAATACAG
ATGCCGCTAATGTGGAAAAATTACGACTGAGTAGTCCCGTACTGGAACGC
AACCTCTCCCCGTCGCTACAGCCCAAGGCCGCAAGCTTTCTAGACCAT
BO24533.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:46:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-RA | 267 | CG34228-PA | 1..264 | 17..280 | 1320 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-RA | 415 | CG34228-RA | 86..349 | 17..280 | 1320 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:46:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 11652140..11652273 | 147..280 | 670 | 100 | Plus |
2R | 25286936 | 2R | 11651942..11652071 | 17..146 | 650 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:46:57 has no hits.
BO24533.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:24 Download gff for
BO24533.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 66..329 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:16 Download gff for
BO24533.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 86..349 | 17..282 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:54 Download gff for
BO24533.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34228-RA | 86..349 | 17..282 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:54 Download gff for
BO24533.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 11651942..11652071 | 17..146 | 100 | -> | Plus |
2R | 11652140..11652273 | 147..282 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:16 Download gff for
BO24533.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 7539447..7539576 | 17..146 | 100 | -> | Plus |
arm_2R | 7539645..7539778 | 147..282 | 98 | | Plus |
BO24533.pep Sequence
Translation from 16 to 298
> BO24533.pep
MWPIVMALIRRNAVYITLPIAGVVGFIGYNIESWISDKYTPYSPSIQELR
AKRLTEESLNTDAANVEKLRLSSPVLERNLSPSLQPKAASFLDH
BO24533.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:57:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34228-PA | 88 | CG34228-PA | 1..88 | 1..88 | 445 | 100 | Plus |