Clone BO24534 Report

Search the DGRC for BO24534

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:34
Vector:pDNR-Dual
Associated Gene/TranscriptCG34230-RA
Protein status:BO24534.pep: Imported from assembly
Sequenced Size:421

Clone Sequence Records

BO24534.complete Sequence

421 bp assembled on 2010-05-18

GenBank Submission: KX799194

> BO24534.complete
GAAGTTATCAGTCGACATGATCTACTCGGACAATTGCTGTTGCTGCGTGG
ATCTGAAGTGCGGAAGCATCCTGATAGCCATCGTTGAGGTGCTAATACGT
GGACTAGATCGCTTCTTTGTTGATCGTGACAGCCTGCTGGGACTTTTTTC
CCTTGTGGTGAGCGGTATCTACGTTATCTGCTGCATTTTTCTACTGCTGG
GAGCAGTTCTGGGCCTGAGATATTTTCTGTTGCCTTACCTCTCAGTTTCC
TGCCTGCGGTTCTTCATTTTAGTTGCCGAGGGCGTGTTTGTAGCCACAGA
GGGCATCATGAATGAATATCTAGTTTTCGATATTCTTCAATCCCTTCTAG
GCTTGTACTTTTGGCTGGTGGTCTACTCCTATTATGATCGCTTAAAGGAC
GCGGCAAGCTTTCTAGACCAT

BO24534.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-RA 390 CG34230-PA 1..387 17..403 1935 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-RA 546 CG34230-RA 48..434 17..403 1935 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11861655..11861788 211..344 670 100 Plus
2R 25286936 2R 11861357..11861469 17..129 565 100 Plus
2R 25286936 2R 11861516..11861602 126..212 435 100 Plus
2R 25286936 2R 11861845..11861903 345..403 295 100 Plus
Blast to na_te.dros performed on 2014-11-28 02:45:51 has no hits.

BO24534.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:06 Download gff for BO24534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 48..434 17..405 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:26:49 Download gff for BO24534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 48..434 17..405 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:30 Download gff for BO24534.complete
Subject Subject Range Query Range Percent Splice Strand
CG34230-RA 48..434 17..405 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:30 Download gff for BO24534.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11861357..11861465 17..125 100 -> Plus
2R 11861516..11861601 126..211 100 -> Plus
2R 11861656..11861788 212..344 100 -> Plus
2R 11861845..11861903 345..405 96   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:26:49 Download gff for BO24534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7748862..7748970 17..125 100 -> Plus
arm_2R 7749021..7749106 126..211 100 -> Plus
arm_2R 7749161..7749293 212..344 100 -> Plus
arm_2R 7749350..7749408 345..405 96   Plus

BO24534.pep Sequence

Translation from 16 to 421

> BO24534.pep
MIYSDNCCCCVDLKCGSILIAIVEVLIRGLDRFFVDRDSLLGLFSLVVSG
IYVICCIFLLLGAVLGLRYFLLPYLSVSCLRFFILVAEGVFVATEGIMNE
YLVFDILQSLLGLYFWLVVYSYYDRLKDAASFLDH

BO24534.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34230-PA 129 CG34230-PA 1..129 1..129 667 100 Plus
CG43183-PA 138 CG43183-PA 1..132 1..126 148 27.4 Plus