Clone BO24540 Report

Search the DGRC for BO24540

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:40
Vector:pDNR-Dual
Associated Gene/TranscriptCG34208-RA
Protein status:BO24540.pep: Imported from assembly
Sequenced Size:184

Clone Sequence Records

BO24540.complete Sequence

184 bp assembled on 2010-05-18

GenBank Submission: KX797154

> BO24540.complete
GAAGTTATCAGTCGACATGAAGTGGCTTAGTTTGTTCCTGGTATTCGGCA
TCCTCGGACTCATCGGCAGTCTGGGCACTTTAGCCCTAGCGGAACCCAAT
CCGGAGCCCAAGGGTCGTCCGCACACAACGCGACGTCCTCGAAACGATAA
CGACAACGATCGACGCGCAAGCTTTCTAGACCAT

BO24540.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-RA 153 CG34208-PA 1..150 17..166 750 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-RA 380 CG34208-RA 23..176 13..166 755 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22333148..22333301 13..166 755 99.4 Plus
Blast to na_te.dros performed on 2014-11-28 02:47:09 has no hits.

BO24540.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:27 Download gff for BO24540.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..176 17..168 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:20 Download gff for BO24540.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..176 17..168 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:58 Download gff for BO24540.complete
Subject Subject Range Query Range Percent Splice Strand
CG34208-RA 27..176 17..168 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:58 Download gff for BO24540.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22333152..22333301 17..168 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:20 Download gff for BO24540.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18220657..18220806 17..168 98   Plus

BO24540.pep Sequence

Translation from 16 to 184

> BO24540.pep
MKWLSLFLVFGILGLIGSLGTLALAEPNPEPKGRPHTTRRPRNDNDNDRR
ASFLDH

BO24540.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34208-PA 50 CG34208-PA 1..50 1..50 268 100 Plus