BO24540.complete Sequence
184 bp assembled on 2010-05-18
GenBank Submission: KX797154
> BO24540.complete
GAAGTTATCAGTCGACATGAAGTGGCTTAGTTTGTTCCTGGTATTCGGCA
TCCTCGGACTCATCGGCAGTCTGGGCACTTTAGCCCTAGCGGAACCCAAT
CCGGAGCCCAAGGGTCGTCCGCACACAACGCGACGTCCTCGAAACGATAA
CGACAACGATCGACGCGCAAGCTTTCTAGACCAT
BO24540.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:47:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-RA | 153 | CG34208-PA | 1..150 | 17..166 | 750 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:47:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-RA | 380 | CG34208-RA | 23..176 | 13..166 | 755 | 99.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:47:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 22333148..22333301 | 13..166 | 755 | 99.4 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:47:09 has no hits.
BO24540.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-18 11:29:27 Download gff for
BO24540.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..176 | 17..168 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:27:20 Download gff for
BO24540.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..176 | 17..168 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:35:58 Download gff for
BO24540.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34208-RA | 27..176 | 17..168 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:35:58 Download gff for
BO24540.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 22333152..22333301 | 17..168 | 98 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:27:20 Download gff for
BO24540.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 18220657..18220806 | 17..168 | 98 | | Plus |
BO24540.pep Sequence
Translation from 16 to 184
> BO24540.pep
MKWLSLFLVFGILGLIGSLGTLALAEPNPEPKGRPHTTRRPRNDNDNDRR
ASFLDH
BO24540.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 02:58:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34208-PA | 50 | CG34208-PA | 1..50 | 1..50 | 268 | 100 | Plus |