BO24544.complete Sequence
265 bp assembled on 2010-05-24
GenBank Submission: KX799741
> BO24544.complete
GAAGTTATCAGTCGACATGTTCCGCATTATCGCTGTGATCTTCGCCCTGG
TAGCAATGGCTTTTGCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTG
GTTCCTGTAGCCCAAGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCA
GCACGTTCCGGTGGTGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGC
TGAAGTCCTACGCTGTTCCCACCTATGGACACCACATCTACCACGGTGCA
AGCTTTCTAGACCAT
BO24544.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:50:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-RA | 234 | CG34267-PA | 1..231 | 17..247 | 1140 | 99.6 | Plus |
CG34268-RA | 252 | CG34268-PA | 1..249 | 17..247 | 850 | 90.4 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-RA | 375 | CG34267-RA | 79..309 | 17..247 | 1140 | 99.6 | Plus |
CG34268-RA | 373 | CG34268-RA | 61..309 | 17..247 | 850 | 90.4 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 500080..500298 | 247..29 | 1080 | 99.5 | Minus |
3L | 28110227 | 3L | 501100..501336 | 29..247 | 790 | 89.9 | Plus |
Blast to na_te.dros performed on 2014-11-28 02:50:31 has no hits.
BO24544.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:46:58 Download gff for
BO24544.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 79..304 | 22..249 | 98 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:37 Download gff for
BO24544.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 84..309 | 22..249 | 98 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:09 Download gff for
BO24544.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34267-RA | 84..309 | 22..249 | 98 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:09 Download gff for
BO24544.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 500078..500304 | 22..249 | 96 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:37 Download gff for
BO24544.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 500078..500304 | 22..249 | 96 | | Minus |
BO24544.pep Sequence
Translation from 16 to 265
> BO24544.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHGASFLDH
BO24544.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34267-PA | 77 | CG34267-PA | 1..77 | 1..77 | 397 | 100 | Plus |
CG34268-PA | 83 | CG34268-PA | 1..83 | 1..77 | 380 | 92.8 | Plus |