Clone BO24544 Report

Search the DGRC for BO24544

Clone and Library Details

Library:BO
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with open reading frames
Original Plate Number:245
Well:44
Vector:pDNR-Dual
Associated Gene/TranscriptCG34267-RA
Protein status:BO24544.pep: Imported from assembly
Sequenced Size:265

Clone Sequence Records

BO24544.complete Sequence

265 bp assembled on 2010-05-24

GenBank Submission: KX799741

> BO24544.complete
GAAGTTATCAGTCGACATGTTCCGCATTATCGCTGTGATCTTCGCCCTGG
TAGCAATGGCTTTTGCTGCTCCTGGTTACATTGAGCCCTCCTACGGAGTG
GTTCCTGTAGCCCAAGTGGTGCCCGTGGTGAAATCTGTTCCAGTGGTGCA
GCACGTTCCGGTGGTGAAGAATGTCCCAGTGGTTCAGCATGTCCCTGTGC
TGAAGTCCTACGCTGTTCCCACCTATGGACACCACATCTACCACGGTGCA
AGCTTTCTAGACCAT

BO24544.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 02:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-RA 234 CG34267-PA 1..231 17..247 1140 99.6 Plus
CG34268-RA 252 CG34268-PA 1..249 17..247 850 90.4 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 02:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-RA 375 CG34267-RA 79..309 17..247 1140 99.6 Plus
CG34268-RA 373 CG34268-RA 61..309 17..247 850 90.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 02:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 500080..500298 247..29 1080 99.5 Minus
3L 28110227 3L 501100..501336 29..247 790 89.9 Plus
Blast to na_te.dros performed on 2014-11-28 02:50:31 has no hits.

BO24544.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-05-24 09:46:58 Download gff for BO24544.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 79..304 22..249 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 21:28:37 Download gff for BO24544.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 84..309 22..249 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 03:37:09 Download gff for BO24544.complete
Subject Subject Range Query Range Percent Splice Strand
CG34267-RA 84..309 22..249 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 03:37:09 Download gff for BO24544.complete
Subject Subject Range Query Range Percent Splice Strand
3L 500078..500304 22..249 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 21:28:37 Download gff for BO24544.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 500078..500304 22..249 96   Minus

BO24544.pep Sequence

Translation from 16 to 265

> BO24544.pep
MFRIIAVIFALVAMAFAAPGYIEPSYGVVPVAQVVPVVKSVPVVQHVPVV
KNVPVVQHVPVLKSYAVPTYGHHIYHGASFLDH

BO24544.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 04:58:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34267-PA 77 CG34267-PA 1..77 1..77 397 100 Plus
CG34268-PA 83 CG34268-PA 1..83 1..77 380 92.8 Plus